Pmer009623.1
Basic Information
- Insect
- Polistes metricus
- Gene Symbol
- Cebpg
- Assembly
- GCA_010416925.1
- Location
- QUOH01000010.1:3070663-3071261[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.7e-14 1.1e-11 44.2 10.9 2 65 24 87 23 87 0.95
Sequence Information
- Coding Sequence
- atggcgcccaaaaataaagaaaacaattctggtaacaagaagaaaaaacaagtttctgaagaagaagatgacgaAGATTATAGGAGACGCCGTGATAGAAATAATCAGGCTGTAAAACGATCAAGAGTTAAAAGTAAATTACGCACGCAACAGACTTTAGAACGTGTAAATCAacttaaaagagaaaatgagctATTagaggagaaaataaaaatgcttaCGAAAGAATTGGGCTTCCTTAAGGATCTTTTCCTTGCTCATGCTGGTTCCAGTCAACATTCAATCAATTTCCAGGATATAGATTTAAATACTCTCTTGGCGGAAGATACAAAACCTCTAGACTTGCCTAAAACAACAGCTGAGCTGTAA
- Protein Sequence
- MAPKNKENNSGNKKKKQVSEEEDDEDYRRRRDRNNQAVKRSRVKSKLRTQQTLERVNQLKRENELLEEKIKMLTKELGFLKDLFLAHAGSSQHSINFQDIDLNTLLAEDTKPLDLPKTTAEL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01098951;
- 90% Identity
- iTF_01255289;
- 80% Identity
- iTF_01234108;