Pdor010303.1
Basic Information
- Insect
- Polistes dorsalis
- Gene Symbol
- Cebpg
- Assembly
- GCA_010416905.1
- Location
- QUOG01000005.1:1641996-1642593[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 9.2 5.7e+03 -2.9 0.1 22 26 13 17 6 22 0.55 2 2 4e-15 2.5e-12 46.3 8.8 2 65 24 87 23 87 0.95
Sequence Information
- Coding Sequence
- atggcgcccaaaaataaagaaaataattctggtcataagaagaaaaaacaagtttctgaagaagaagatgacgaaGATTATAGGAGACGCCGTGATAGAAATAATCAGGCTGTGAAACGATCAAGAGTTAAAAGTAAATTACGCACGCAACAGACTCTAGAACGTGTAAATCAacttaaaagagaaaatgagctattagaggagaaaataaaaatgcttaCGAAAGAATTGGGCTTTCTTAAGGATCTTTTCCTTGCTCATGCTGGTTCCAGTCAACATTCAATCAATTTCCAGGATATAGATTTAAATACTCTCTTGGCGGAAGATACAAAACCTCTAGACTTGCCTAAAACAACAGCTGAGCTGTAA
- Protein Sequence
- MAPKNKENNSGHKKKKQVSEEEDDEDYRRRRDRNNQAVKRSRVKSKLRTQQTLERVNQLKRENELLEEKIKMLTKELGFLKDLFLAHAGSSQHSINFQDIDLNTLLAEDTKPLDLPKTTAEL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01098951;
- 90% Identity
- iTF_01255289;
- 80% Identity
- -