Basic Information

Transcription Factor Domain

TF Family: ARID
Domain: ARID domain
PFAM: PF01388
TF Group: Helix-turn-helix
Description: This domain is know as ARID for AT-Rich Interaction Domain [2], and also known as the BRIGHT domain [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.3 5.7e+02 0.9 0.0 13 37 37 61 4 66 0.66

2 8 0.076 1.5e+02 2.8 0.0 12 39 100 127 92 130 0.81

3 8 0.016 30 5.0 0.0 9 39 161 191 154 195 0.84

4 8 0.058 1.1e+02 3.2 0.0 14 39 198 223 191 227 0.81

5 8 0.17 3.3e+02 1.7 0.0 16 39 232 255 224 259 0.75

6 8 0.15 2.9e+02 1.9 0.0 15 39 263 287 255 291 0.77

7 8 0.24 4.5e+02 1.3 0.0 14 39 294 319 288 323 0.80

8 8 1.9 3.6e+03 -1.6 0.0 16 37 328 349 320 350 0.72

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.3	5.7e+02	0.9	13	37	37	61	4	66	0.66
2	8	0.076	1.5e+02	2.8	12	39	100	127	92	130	0.81
3	8	0.016	30	5.0	9	39	161	191	154	195	0.84
4	8	0.058	1.1e+02	3.2	14	39	198	223	191	227	0.81
5	8	0.17	3.3e+02	1.7	16	39	232	255	224	259	0.75
6	8	0.15	2.9e+02	1.9	15	39	263	287	255	291	0.77
7	8	0.24	4.5e+02	1.3	14	39	294	319	288	323	0.80
8	8	1.9	3.6e+03	-1.6	16	37	328	349	320	350	0.72

Coding Sequence: ATGTCGATATACATCGATTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAGCTCAAAATGTCGATATACATCGACTATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATATCGATCTACATCGATAATCGAAACTCAAAATATCGATATACATCGACTATCAAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATCTACATCGACAATCGATACTGAACATATCGATGTATATCGACAATCGAAACTCAAAATGTCGATATACATCGACAATCGAAACTCAAAATGTCGATATACATCGACAATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATCTACATCGACTATCGAAACTCAAAATGTCGATATACATCGACAATCGAAACTCAAAATATCGATATACATCGACAATCGATACTGAACATATCGATGTATATCGACAATCGAAACTCAAAATGTCGATCTACATCGACAATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATCTACATCGACTATCGAAACTCAAAATATCGATCTACATCGACAATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAACCCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATCTACATCGACTATCGAAACTCAAAATTTCGATATACATCGATAATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCCATCTACATCGACTATCGAAACTCAAAATATCGATCTACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATCGAAACTCAAAATGTCGATATACATCGACTATTGAAACCCAAAATATCGATATACATCGACTATTGA
Protein Sequence: MSIYIDYRNSKCRYTSTIEAQNVDIHRLSKLKISIYIDYRNSKYRSTSIIETQNIDIHRLSKLKISIYIDYRNSKCRSTSTIDTEHIDVYRQSKLKMSIYIDNRNSKCRYTSTIETQNIDLHRLSKLKMSIYIDYRNSKCRYTSTIETQNIDIHRQSILNISMYIDNRNSKCRSTSTIETQNIDLHRLSKLKMSIYIDYRNSKYRSTSTIETQNIDLHRLSKLKMSIYIDYRNSKCRYTSTIETQNIDLHRLSKLKMSIYIDYRNSKFRYTSIIETQNIDLHRLSKLKMSIYIDYRNSKYRSTSTIETQNVDIHRLSKLKMSIYIDYRNSKCRYTSTIETQNVDIHRLLKPKISIYIDY

Sequence clustering based on sequence similarity using MMseqs2