Pequ031871.1
Basic Information
- Insect
- Platygaster equestris
- Gene Symbol
- Atf2
- Assembly
- GCA_030522785.1
- Location
- JAPYZK010041022.1:1-1146[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.028 45 5.2 1.9 22 41 34 53 32 53 0.85 2 2 3.8e-10 6.2e-07 30.4 16.5 3 65 44 106 43 106 0.95
Sequence Information
- Coding Sequence
- aaattaaaacaaGTCCTGGGAAAAAGCAGCGAGACATATCAAAGTCGTCGCGAGATTCCCGAGAGCGGGCATGGAGCGGGCGCATTGTGCGAGggcatgaaaaaaaagggcTGCACCAGCGAGCTGCAGAAGAAGAAGCAAGAGCTGCGCGAGCGTAATCGCGCGAGCTCAATGCGCTGTCGTGCCAGGCGAAAAGAATTGACCCAGCAGTTGCAGCGGACCATCAGTTGCGCTAATGAAAAGAACGCTGCATTGCAGCTGGAGATTAAAAATCTCCACGCCGAAGTCGCGAGGCTGAAAACGCTCCTCTTGGCGCACAAAGACTGCTCCGTCACCAAGGCCCTGGAAAAAG
- Protein Sequence
- KLKQVLGKSSETYQSRREIPESGHGAGALCEGMKKKGCTSELQKKKQELRERNRASSMRCRARRKELTQQLQRTISCANEKNAALQLEIKNLHAEVARLKTLLLAHKDCSVTKALEK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -