Ppen019666.1
Basic Information
- Insect
- Platycnemis pennipes
- Gene Symbol
- -
- Assembly
- GCA_933228905.1
- Location
- CAKOGJ010000283.1:366866-374639[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 18 3.6e-06 0.0026 21.0 1.0 1 23 104 126 104 126 0.97 2 18 0.012 8.5 10.0 2.5 1 20 132 151 132 154 0.92 3 18 9e-05 0.064 16.6 0.9 1 23 160 182 160 182 0.98 4 18 1.3e-05 0.0096 19.2 3.7 1 21 188 208 188 210 0.95 5 18 1.3e-05 0.009 19.3 4.6 1 23 216 238 216 238 0.99 6 18 1.3e-05 0.009 19.3 5.3 1 23 244 266 244 266 0.97 7 18 8.3e-07 0.00059 23.1 5.4 1 23 272 294 272 294 0.96 8 18 4.7e-08 3.3e-05 27.0 2.7 1 23 300 322 300 322 0.98 9 18 3.5e-05 0.025 18.0 6.7 1 23 328 350 328 350 0.97 10 18 9.1e-06 0.0065 19.8 4.6 1 23 356 378 356 378 0.97 11 18 2.8e-07 0.0002 24.5 2.9 1 23 384 406 384 406 0.98 12 18 5.3e-06 0.0038 20.5 8.0 1 23 412 434 412 434 0.98 13 18 5.1e-06 0.0037 20.6 8.1 1 23 440 462 440 462 0.98 14 18 2.4e-07 0.00017 24.7 7.7 1 23 468 490 468 490 0.98 15 18 0.0005 0.36 14.3 8.8 1 21 496 516 496 518 0.94 16 18 4.5e-05 0.032 17.6 0.4 1 23 524 546 524 546 0.98 17 18 0.0068 4.9 10.7 3.9 1 23 552 574 552 574 0.98 18 18 7.4e-08 5.3e-05 26.4 0.5 1 23 580 602 580 602 0.99
Sequence Information
- Coding Sequence
- ATGAGATTTCCTGGGCAGGATATTAAAGGGCATGTGACTGCGGAAGGTCTAGTTAAAGCCGGTGTCGTTGGTGACCAAGAATTGGCTAAAAATCTTGGTGTTGAAATGGTGCAAAACATGTACAAGGTGAATGTGGATGATATAAATCAGTTACTGGCATATCATGAGGTGTTTGGGAAACTACAGAATGAAATGGCATTGAGTGCAAATCCAGCCCTGGCATGTCAGACTAAACCAGCAGAAGGCACGGGTAATGCCACACCCACCACTACCACGGCCGGAGCTGCTGCAGTGGTTGCCACTGGCACCCATGTAtgtgacatatgtgggaagatattcccattccgttaccaactaattgtccaccgcaggtaccacactgaaaagaaaccttttacttgtcaagtgtgtggaaaggcttttgcatgcaatgctgaattggcacgccatggcaaatgtcacctgggcggtagcctttatacctgtggagtatgttttcatgtttttgccagtgccagtggactggaacgtcattccaaacgccacgccggggacaagccctatgtttgtactgtgtgtggtaagtcctttgcaagaaaggagcacttggacaaccacacccgatgccacactggggagacgccgtatcgttgccaatactgcgcaaagaccttcacgcgcaaggagcacatggtgaaccatgtgcggaagcacaccggtgagactccccatcgttgtgacatttgtaagaaatcattcacacgcaaagagcacttcatgaatcatgtcatgtggcatacaggtgaaaccccgcatgcttgccagatgtgtgggaagaagtacacgcggaaggagcacctgaacaaccacatgaggagccacaccaacgacacacccttccgctgtgagatctgcgggaagtccttcacccggaaggagcacttcacgaaccacattatgtggcacaccggggagacacctcatcgctgcgacttctgctccaagaccttcacgcgcaaggagcacctgctgaaccacgtccgccaacatacgggtgagtccccccaccgatgtggctactgcgccaagtccttcactcgcaaggagcatctcatcaaccatgtacgccaacacacaggcgagactcccttccggtgccagtactgccccaaggcgttcacccgaaaggaccacctggtgaaccacgtgcgccagcacactggggagtcgccgcacaagtgccagtactgcaccaagacgttcacgaggaaggagcacctgaccaaccacgtgcgccaacacacgggtgagtccccccaccgctgccactactgctccaagactttcacacgcaaggaacaccttgtgaatcacgttcgcatccacacaggggagtctccacaccgctgtgagtactgcaacaagacgttcacgcgcaaggagcacctgaccaaccacatgcgccagcacacaggcgagaccccccactgctgcaacgtttgctccaagccattcacgcggaaggagcacctgatcaaccacatgcgctgccattctggggagcgtcccttcagctgtggggagtgcggcaagtccttcccgctgaagggcaacctgctgttccatcagaggtcgcactctcgagagcgcccttacaactgtgacgtctgtggcaaggattttatgtgcaaggggcatctagtgagtcacaaacgcagccattcaggtgaccgcccctatagttgtggggattgtgggaagtcctttgtagagaagggcaacatgctccgccacatgcgcaagcacacagAGAACAATATTTCTATTCCCGCTGCAAATGGCTGCTTTCATAGTGCCATGTTTCACGTTCACTTCTTGTTTCATTTGACTTTTTTAACCAGTCATGCTGGTACCATAGGCCTTAACCAAGTGAACTCATGA
- Protein Sequence
- MRFPGQDIKGHVTAEGLVKAGVVGDQELAKNLGVEMVQNMYKVNVDDINQLLAYHEVFGKLQNEMALSANPALACQTKPAEGTGNATPTTTTAGAAAVVATGTHVCDICGKIFPFRYQLIVHRRYHTEKKPFTCQVCGKAFACNAELARHGKCHLGGSLYTCGVCFHVFASASGLERHSKRHAGDKPYVCTVCGKSFARKEHLDNHTRCHTGETPYRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHFMNHVMWHTGETPHACQMCGKKYTRKEHLNNHMRSHTNDTPFRCEICGKSFTRKEHFTNHIMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCGYCAKSFTRKEHLINHVRQHTGETPFRCQYCPKAFTRKDHLVNHVRQHTGESPHKCQYCTKTFTRKEHLTNHVRQHTGESPHRCHYCSKTFTRKEHLVNHVRIHTGESPHRCEYCNKTFTRKEHLTNHMRQHTGETPHCCNVCSKPFTRKEHLINHMRCHSGERPFSCGECGKSFPLKGNLLFHQRSHSRERPYNCDVCGKDFMCKGHLVSHKRSHSGDRPYSCGDCGKSFVEKGNMLRHMRKHTENNISIPAANGCFHSAMFHVHFLFHLTFLTSHAGTIGLNQVNS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00797268;
- 90% Identity
- iTF_00797268;
- 80% Identity
- -