Basic Information

Insect: Phormia regina
Gene Symbol: -
Assembly: GCA_001735585.1
Location: MINJ01053284.1:1228-2520[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0029 0.3 12.6 5.0 1 23 104 127 104 127 0.94

2 7 2.5e-05 0.0026 19.1 1.2 1 23 134 157 134 157 0.97

3 7 0.00023 0.024 16.1 1.5 1 23 162 184 162 184 0.98

4 7 0.00037 0.039 15.4 0.8 1 23 190 213 190 213 0.92

5 7 0.00032 0.034 15.6 0.8 1 23 219 241 219 241 0.97

6 7 6.4e-06 0.00068 20.9 2.8 3 23 249 269 248 269 0.97

7 7 0.27 28 6.4 0.1 1 12 275 286 275 289 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0029	0.3	12.6	5.0	1	23	104	127	104	127	0.94
2	7	2.5e-05	0.0026	19.1	1.2	1	23	134	157	134	157	0.97
3	7	0.00023	0.024	16.1	1.5	1	23	162	184	162	184	0.98
4	7	0.00037	0.039	15.4	0.8	1	23	190	213	190	213	0.92
5	7	0.00032	0.034	15.6	0.8	1	23	219	241	219	241	0.97
6	7	6.4e-06	0.00068	20.9	2.8	3	23	249	269	248	269	0.97
7	7	0.27	28	6.4	0.1	1	12	275	286	275	289	0.91

Sequence Information

Coding Sequence: atggataaaaatactttaaatttgatCGAAACTTATGCCAAATTTCCTCAACTATATGATGGTAATCATCCGTTATATGGAAATGTCGATGAAAAACTAAACTCATTATCACAATTCGCAAAAGAACTTTTACAATATTATGATATAGATCTCGAAATAGAAACTCTCTCCAATGTCCTAAGACAATTGCAATCTTGGTATTATCATGCCAAGACCCgccatcaaaataaaaagagaaagttAAATCAACACGAAATGGTATACTTTACAAAGTGTTCTTTTCTTCCCGTCCAAcgtttaaatgataaatatttttgcaaaatttgcaaaaaatgtttcaatatgaGAAGTAGTCTGGACGGCCATCTGTTTAGATACCATCAAATTGGTGATTTATCCTTTGAGTGTGATCAATGTGGCAAAAAATTCTCCCAGAAAACCATACTGCAACAACATGTACAACGTATGCATAATAGTCGAAAATATCGCTGTGAATTTTGCGATAAACTATTTGCTACAAAATCGGAACTTAGCTTTCACACGCGAGTCCATACGGCTGAAAAGCCACATGTTTGTGAATTTTGCGGCAAATCATTTAGAATTAAAACTCAATTGGGCTATCATATCACCGCCATACACACTAAGATACGAGCATTCAAATGCACCATGTGTCCCAAGGATTTTCTTACGAAACGTGATCTGACAGATCACGTTAAAGCCCACTTAAATATACGCGACAAAATATGTGAAACATGTGGCAAAGGATTTTCAAATAATCACTCCTTTAGGCGTCATCGTCAAATACATTCGGATGTTAAACGTTATGAGTGTGAATTATGTGAAGAGAAATTTAAGCAATTAATAGatGAAACTCTATATTTACTTTACTCCTAA
Protein Sequence: MDKNTLNLIETYAKFPQLYDGNHPLYGNVDEKLNSLSQFAKELLQYYDIDLEIETLSNVLRQLQSWYYHAKTRHQNKKRKLNQHEMVYFTKCSFLPVQRLNDKYFCKICKKCFNMRSSLDGHLFRYHQIGDLSFECDQCGKKFSQKTILQQHVQRMHNSRKYRCEFCDKLFATKSELSFHTRVHTAEKPHVCEFCGKSFRIKTQLGYHITAIHTKIRAFKCTMCPKDFLTKRDLTDHVKAHLNIRDKICETCGKGFSNNHSFRRHRQIHSDVKRYECELCEEKFKQLIDETLYLLYS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00045664;
90% Identity: -
80% Identity: -