Basic Information

Insect: Phormia regina
Gene Symbol: -
Assembly: GCA_001735585.1
Location: MINJ01169503.1:6727-10042[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00023 0.024 16.1 1.6 2 23 128 150 127 150 0.95

2 7 0.0066 0.69 11.5 0.2 1 23 157 180 157 180 0.92

3 7 1.5e-05 0.0015 19.8 0.1 1 23 185 207 185 207 0.98

4 7 0.00084 0.088 14.3 0.8 1 23 213 236 213 236 0.92

5 7 2.7e-06 0.00029 22.1 2.4 1 23 242 264 242 264 0.99

6 7 1.4e-05 0.0014 19.9 1.2 3 23 272 292 271 292 0.97

7 7 0.0019 0.2 13.2 2.7 1 23 298 321 298 321 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00023	0.024	16.1	1.6	2	23	128	150	127	150	0.95
2	7	0.0066	0.69	11.5	0.2	1	23	157	180	157	180	0.92
3	7	1.5e-05	0.0015	19.8	0.1	1	23	185	207	185	207	0.98
4	7	0.00084	0.088	14.3	0.8	1	23	213	236	213	236	0.92
5	7	2.7e-06	0.00029	22.1	2.4	1	23	242	264	242	264	0.99
6	7	1.4e-05	0.0014	19.9	1.2	3	23	272	292	271	292	0.97
7	7	0.0019	0.2	13.2	2.7	1	23	298	321	298	321	0.98

Sequence Information

Coding Sequence: ATGTGGTCCTTGAAACCAAGATCCAtgtttaaatttcatgaaaaatttaaatatttttcgAATCCACTTACTCTTAACGAATGGGACGAAACTACAGGCAAGTTTATCGATATTTTATCCAAATTTCCAATACTGTACGATAAGAAGCACTCGTCACATAATAAATTAGAGAATAGGCGAACGGCTATATCCGAAATACGTAATACTCTTCTAACAGAACACAACATAGACTTCAACGAAGAGATGCTATCCAATGCCATATCGCAATTACAAATTTGGTACTACCGGATGAAACGGCGTAAAggaaatttgaggaaatatgaggataaatattttaaattgtgcaAATTTATACCGGGAAAACTATTGAAGGAAAAAATTCCGTGTAGCATTTGTGAACAAGTATTTTACACTGAACACACTTTAAAACATCATTTAGCCAAATTACACAAAGTCGGACATTTCTCATATAAATGTGAACTATGTGGCAAGGAACTTGTTTCGAAAACAGCAGTCAGATATCATAATATAAGGGTACACGCTGAAAAGAAATTTCCCTGTGAGTTTTGTggaaaattatttgctttaacCTCGGAATTGAAGGTTCATATACGAGTCCACACGGCCGAAAAGCCACATGTTTGTGAATTATGTGGCAAAAGCTTTAGACTACGAAATCTCTTGGGTCTTCACGTTACACGTATGCACACCAGAATCCGAGCTTTCAAATGCACCATGTgtcccaaagatttttactATAATAAGGATCTAAGAGATCATATGAAAAGCCATTTAAATATACGTGATAAAATATGTGAAACTTGTGGTAAAGGTTTTACAAATTGTAATGCTCTGATACGACATCGTCAAATACACTCAGAAGTcaagaaatttaaatgtaaactgTGTGATGCGAAATTTCATCAATTTGTTGGACTTAATGGCCATATGAAACGTACCcattatatagtaaaaaaagtttag
Protein Sequence: MWSLKPRSMFKFHEKFKYFSNPLTLNEWDETTGKFIDILSKFPILYDKKHSSHNKLENRRTAISEIRNTLLTEHNIDFNEEMLSNAISQLQIWYYRMKRRKGNLRKYEDKYFKLCKFIPGKLLKEKIPCSICEQVFYTEHTLKHHLAKLHKVGHFSYKCELCGKELVSKTAVRYHNIRVHAEKKFPCEFCGKLFALTSELKVHIRVHTAEKPHVCELCGKSFRLRNLLGLHVTRMHTRIRAFKCTMCPKDFYYNKDLRDHMKSHLNIRDKICETCGKGFTNCNALIRHRQIHSEVKKFKCKLCDAKFHQFVGLNGHMKRTHYIVKKV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00045592;
90% Identity: iTF_01259477;
80% Identity: -