Preg025614.1
Basic Information
- Insect
- Phormia regina
- Gene Symbol
- HSF
- Assembly
- GCA_001735585.1
- Location
- MINJ01026935.1:2099-2875[-]
Transcription Factor Domain
- TF Family
- HSF
- Domain
- HSF_DNA-bind domain
- PFAM
- PF00447
- TF Group
- Helix-turn-helix
- Description
- Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-23 2.6e-19 70.6 1.0 1 99 14 104 14 105 0.92
Sequence Information
- Coding Sequence
- ATGGAACAAGAAATAGTAAAGCATCAAAAAGTTCAGAAATTCATCAAAAGACTATACAACATAGTATCAGACCCTAACATACCTGAAATCACATGGAGCAATAATGGTACTACTgttttaataccaaacaaaGAAAAGTTTCGAACTAACACAATGtacaaaatatctaaaacaaAGGAATACACCGCATTCCTACGTTCACTGCATCACTACAATTTTATGAAGGTAAAAAGGACAGATGACAATAGTGATGAGTACTTccataaaaacttttgtaaagaTAATGAAGATCTTTTGTGCTTGATTAGACGTGTAAGAGAAAGGAATAATACAGGGACTGAGATTGGCTTGCTTAAGCGTGACTTTCTGTCTTTGCAGAATAATATCAGTGTAAACAATCAGAATATCTATACATTGTCGGAGGATGTAAGTTCTTTGCAAGATAGAGTTGATAGACAAGAGAAGACTATAAGTGGATTGATAGAAATATTAGGAAAGGTGTTTAGGGTTGGTGTTAGTAATGAGAATGTACAACCAACGCTAAAAAGTAATGTGTTTGAGCTAAACGATATATTTAACAAGCAAAGTAATACGGATACACAAATACGGCCTGTTCCTAAGCTACAAATAGCAAAAAGAGATTCGATTggtaaaaagaagaagaaagaaGAGGTAAAAGTAGAAGAGATAGAATCACCAGTAGTGAAGAATATGCCAGAATTTGACAGTCATGATAGTGATGAGATAAAGGATATGTACAAGGATCTGTTTTATTGA
- Protein Sequence
- MEQEIVKHQKVQKFIKRLYNIVSDPNIPEITWSNNGTTVLIPNKEKFRTNTMYKISKTKEYTAFLRSLHHYNFMKVKRTDDNSDEYFHKNFCKDNEDLLCLIRRVRERNNTGTEIGLLKRDFLSLQNNISVNNQNIYTLSEDVSSLQDRVDRQEKTISGLIEILGKVFRVGVSNENVQPTLKSNVFELNDIFNKQSNTDTQIRPVPKLQIAKRDSIGKKKKKEEVKVEEIESPVVKNMPEFDSHDSDEIKDMYKDLFY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -