Preg011058.1
Basic Information
- Insect
- Phormia regina
- Gene Symbol
- -
- Assembly
- GCA_001735585.1
- Location
- MINJ01052391.1:1199-1636[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.7e-08 3.3e-05 24.8 0.9 8 46 30 68 28 82 0.91 2 2 4.3 8.4e+03 -2.1 0.1 52 60 127 135 117 140 0.48
Sequence Information
- Coding Sequence
- ATGAACCATGACAACGATCCAAAGCAATTCCATTCTGATATGAATCTAAGTTGTCCATTCTACGAGACGGATTACAAAATAGGGTGGAAACGTGAACGCAATCGCTTAGCTGCGAAAAAAAGTAGAGAAAAGAAGGCATTGCACATGAAGTTTTTGGAAGACAAAGGTAGAATTATTGAGAGACAATTGGACGAGCTTAAGGAGTTAGTGCTTGACTATGATAGCTTGCTGGATAAGATGTTGACTTTTTTTGAAACCAATGCGCCGTACGATCCAGTTTTGGTTTTCAATTTGTTGTATAGCATGTATAGAAAGGATGAAAGCTTTGTGAGAATGGTTGTGATAGATAAAAAGTTGTACGTACATAATCAAAGAATAGAGCGATTGTTAGACCGAATAAGTCAAATGCTCAACAGAACAATGCAAGatgatagataa
- Protein Sequence
- MNHDNDPKQFHSDMNLSCPFYETDYKIGWKRERNRLAAKKSREKKALHMKFLEDKGRIIERQLDELKELVLDYDSLLDKMLTFFETNAPYDPVLVFNLLYSMYRKDESFVRMVVIDKKLYVHNQRIERLLDRISQMLNRTMQDDR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -