Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0023 0.37 12.4 1.3 1 20 110 129 110 131 0.96

2 6 9.3e-05 0.015 16.8 0.7 1 23 137 162 137 162 0.97

3 6 0.0023 0.37 12.4 1.1 2 21 180 199 179 200 0.94

4 6 0.19 30 6.4 0.3 1 23 219 242 219 242 0.91

5 6 0.0051 0.8 11.3 1.6 1 21 251 271 251 272 0.95

6 6 0.00052 0.082 14.4 1.9 1 23 280 303 280 303 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0023	0.37	12.4	1.3	1	20	110	129	110	131	0.96
2	6	9.3e-05	0.015	16.8	0.7	1	23	137	162	137	162	0.97
3	6	0.0023	0.37	12.4	1.1	2	21	180	199	179	200	0.94
4	6	0.19	30	6.4	0.3	1	23	219	242	219	242	0.91
5	6	0.0051	0.8	11.3	1.6	1	21	251	271	251	272	0.95
6	6	0.00052	0.082	14.4	1.9	1	23	280	303	280	303	0.97

Coding Sequence: ATGCTTGTGATCATTCTAGAATCCGACGAGGACCCTGTCCAAATTAAAATCGAAGACGTCAGGACGCTTCCTCCCGCGCATTACGGCGAGCCCTCGACTTCGCAGCGCAAATCGAAAGTCGAATTACCGAGAGTATCGGCTTCCGCAGGTACACACATACACTTTTCCCACGATTTCCCGCGTAATGATTCTCCGCTGATCGCCTCGTCGACTTCCATTGCAGATGCCTCGAGCCGCATAGTCCTGTTCTGCTCGACCTGCGGCCCCAAGTCCACCGATCTGCGCAGCAAGACCAAGAAGTGCGGCAGCTGCAAGAGCCCGCTGCGCTACAAGTGCAGCCTCTGCGAGAAGAACTACTCGACCCTCACGAGGCTGCGCTACCACATCTATTACGGCTGCAGCGGCGACTACCGCTGCACCTACCCGGGCTGCGACTACGTGACCCACGACTGGTCGGAATTGCGGGATCACCAGCGCCTCCAGCACAACGTCCTCCCGGGCGTTCCCGGCGCGCCCACCTCGGCCGAGGTCAACGTCCAGTGCTCGCACTGCTCCAAGTGGTTCCGGCAGATGCGATCGCTCCAGAAGCACCAGCTGATCTGCGGCGACGGCGGCGAGGGTGGCGGCCCGGAGCGCAAGCCCAAAAAAATGTTCTACTCCTGCGCGTTCTGCGACTTCTCGGCCAAGCGGCTCAAGGACATCAAGCAGCACGAGGAGCTGGTGCACAGGATCTTGAAGAAGGACGGTTTCTTCAATTGCCCCTACTGCTCGAAGAAGGCCGCCACCATGAAGAAGCTCAAGTCCCATCTGCGACACTGCACGCTCAAGGTGCACAGGTTCAGGTGCGAGCACTGCGACTACAAGGGCAAGAGCAAGGCCTCGTTCGTCGAGCATCTGAGGAACGTTCATCCGGATGTCTACAAACTGGGCTATTCCAAGTCGTAG
Protein Sequence: MLVIILESDEDPVQIKIEDVRTLPPAHYGEPSTSQRKSKVELPRVSASAGTHIHFSHDFPRNDSPLIASSTSIADASSRIVLFCSTCGPKSTDLRSKTKKCGSCKSPLRYKCSLCEKNYSTLTRLRYHIYYGCSGDYRCTYPGCDYVTHDWSELRDHQRLQHNVLPGVPGAPTSAEVNVQCSHCSKWFRQMRSLQKHQLICGDGGEGGGPERKPKKMFYSCAFCDFSAKRLKDIKQHEELVHRILKKDGFFNCPYCSKKAATMKKLKSHLRHCTLKVHRFRCEHCDYKGKSKASFVEHLRNVHPDVYKLGYSKS

Sequence clustering based on sequence similarity using MMseqs2