Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.2 1.5e+02 4.9 0.4 18 44 21 44 11 44 0.86

2 8 0.96 7.1e+02 2.8 3.8 6 29 38 61 37 73 0.78

3 8 0.35 2.5e+02 4.2 3.7 15 35 77 103 63 106 0.69

4 8 0.21 1.5e+02 4.9 1.1 11 38 100 126 95 132 0.76

5 8 0.0022 1.6 11.2 1.1 17 43 135 163 121 164 0.68

6 8 8.3 6.1e+03 -0.2 0.0 18 26 171 179 165 181 0.84

7 8 0.077 56 6.3 1.6 5 29 187 211 184 220 0.80

8 8 0.0001 0.074 15.5 6.1 12 44 250 279 212 279 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.2	1.5e+02	4.9	0.4	18	44	21	44	11	44	0.86
2	8	0.96	7.1e+02	2.8	3.8	6	29	38	61	37	73	0.78
3	8	0.35	2.5e+02	4.2	3.7	15	35	77	103	63	106	0.69
4	8	0.21	1.5e+02	4.9	1.1	11	38	100	126	95	132	0.76
5	8	0.0022	1.6	11.2	1.1	17	43	135	163	121	164	0.68
6	8	8.3	6.1e+03	-0.2	0.0	18	26	171	179	165	181	0.84
7	8	0.077	56	6.3	1.6	5	29	187	211	184	220	0.80
8	8	0.0001	0.074	15.5	6.1	12	44	250	279	212	279	0.93

Coding Sequence: ATGTCCAGCGACCAATCCGAAGCAAGAAGTCCGGTTATAAAAAAAGAGCAAGTAAGATTTTCTTGCTCAGGATGTGAAAAATCATTTGACAAGAAAGACACTCTTAGGTCACATGTCAATCGTGTTCATAAGCGAATCGGGGCCACTACTTGTAAGGAATGTGGAAAAACATTTACAGCCGAATGGAGTTTCAAAAAACACTTTATGAAATTTCACCAAGGAATCGTTGATAACTTTAAATGTGATATTTGCGGGGGAAATTATACAAACAAATCTTCGTTGCAATTTCACAAAAATACTAACCACCTGAAGAAATTCAATTTCTTTTGTGACATCTGCGGTAAAGGATTCTTTTATCAAAGCACCTTAAAACGACATAATCAAGATTCCCATAACAATGGAGTTCCTTGCTTACCATGCACCGCGGAAGGATGTGGGAAAATCTTTGCAAGCACCAGCGGTTTAAAATACCATATTAGGGCCGAACATACTTCAGACAAACCTACACTTGTTTGTGAAGAGTGTGGAAAAATTTTCGATCATCCTTATAGATATAACAAGCATATTAGACGGCATAAAAATGGGCGTCCGAGGCACAAATGCAGTATTTGCCAAAAAGTTTTAGCGTCTAAAGATAGCCTCTATGCTCATATTCGtattcataccggagaaaaacCGTTTGTTTGCGAGCAGTGTGGAATAGGTTTTACCAAAAAGGGCGGTCTTCGTGTTCATATGGTAGTACATACCAAAGAAAAACCACATGTCTGTAAATATTGCGGCAAGAAATACACTCAGCGGTCTCCTCTCATCCGACATATACAACTGAATCATCCAGAACTAGCGGACCAAGCGCGACAGTTGAAAGACGATGGCATTTGA
Protein Sequence: MSSDQSEARSPVIKKEQVRFSCSGCEKSFDKKDTLRSHVNRVHKRIGATTCKECGKTFTAEWSFKKHFMKFHQGIVDNFKCDICGGNYTNKSSLQFHKNTNHLKKFNFFCDICGKGFFYQSTLKRHNQDSHNNGVPCLPCTAEGCGKIFASTSGLKYHIRAEHTSDKPTLVCEECGKIFDHPYRYNKHIRRHKNGRPRHKCSICQKVLASKDSLYAHIRIHTGEKPFVCEQCGIGFTKKGGLRVHMVVHTKEKPHVCKYCGKKYTQRSPLIRHIQLNHPELADQARQLKDDGI

Sequence clustering based on sequence similarity using MMseqs2