Pcog065415.1
Basic Information
- Insect
- Philonthus cognatus
- Gene Symbol
- Runx1_1
- Assembly
- GCA_932526485.1
- Location
- CAKOBG010000396.1:1193474-1193881[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1e-53 1.6e-49 169.1 0.0 4 94 34 124 31 132 0.95
Sequence Information
- Coding Sequence
- ATGCATCTGGCCAGCGAGGTCAGCTCCACGACGGGTCACTACGACCGCAACTACGGAAACTTGACGGCGGAGATGCTCGCCGAAAGGACGCTGGACGGACTCCTCGCCGAGCACCCGGGGGAGCTCGTGAGGACGGGAAGTCCGCACGTCGTGTGCACGGTGTTGCCGCCGCACTGGAGGTCCAACAAGACGCTACCTGTGGCTTTCAAGGTCGTCGCCCTGGGGGATGTGGGCGACGGCACCGTCGTCACCGTGCGCGCTGGTAACGATGAGAACTACTGCGCCGAACTGAGGAACTGTACCGCCGTCATGAAGAACCAAGTAGCTAAATTTAATGATCTTAGATTCGTCGGAAGAAGTGGAAGAGGTGAGTTATCTATAACACAACAAAAAATCCTTTTACTTTGA
- Protein Sequence
- MHLASEVSSTTGHYDRNYGNLTAEMLAERTLDGLLAEHPGELVRTGSPHVVCTVLPPHWRSNKTLPVAFKVVALGDVGDGTVVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGELSITQQKILLL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01284034; iTF_00260419; iTF_01566025; iTF_01104045; iTF_00766185; iTF_00767884; iTF_00885680; iTF_00029969; iTF_01561796; iTF_00031570; iTF_00920436; iTF_01295765; iTF_00998326; iTF_00436250; iTF_00328932; iTF_01014027; iTF_00415663; iTF_00167473; iTF_00386962; iTF_01310101; iTF_01441717; iTF_00165846; iTF_00910296; iTF_01226394; iTF_00436253; iTF_01368799; iTF_00735258; iTF_00025809; iTF_01225435; iTF_00625919; iTF_00465761; iTF_00956087; iTF_00064958;
- 90% Identity
- iTF_00465761; iTF_01238339; iTF_01014027; iTF_00025809; iTF_00920436; iTF_00845653; iTF_01289524; iTF_00260419; iTF_00885680; iTF_01295765; iTF_00436253; iTF_00998326; iTF_00956087; iTF_00740586; iTF_00735258; iTF_00064958; iTF_00625919;
- 80% Identity
- -