Phum003675.1
Basic Information
- Insect
- Pediculus humanus
- Gene Symbol
- -
- Assembly
- GCA_000006295.1
- Location
- NW:157516-158640[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 11 0.039 2.6 8.0 0.2 5 17 53 65 50 66 0.86 2 11 0.00092 0.061 13.1 2.4 2 23 75 97 74 97 0.94 3 11 0.0035 0.23 11.3 1.1 1 23 100 122 100 122 0.97 4 11 4.8e-05 0.0032 17.1 2.5 2 23 127 149 127 149 0.97 5 11 0.0012 0.083 12.7 0.6 1 23 157 179 157 179 0.98 6 11 0.018 1.2 9.1 0.9 1 23 185 208 185 208 0.94 7 11 5e-08 3.3e-06 26.5 0.8 1 23 212 234 212 234 0.98 8 11 0.00022 0.015 15.0 1.0 1 23 245 267 245 267 0.98 9 11 2.5e-06 0.00017 21.2 2.0 1 23 274 296 274 296 0.98 10 11 7.9e-06 0.00053 19.6 1.4 1 23 302 324 302 324 0.97 11 11 0.0029 0.2 11.5 6.6 1 23 330 352 330 352 0.98
Sequence Information
- Coding Sequence
- ATGGTGTTTATTCATATAGAATTCCTGTACGAGATATTAATTTCAGGATCGAACCAATTTGAGTTGATACACAACCAAAAATCTAGGTGTGGAAATTTGTCATTCAACAATAAAGATAgtaaaaaaagtgtaaatgaaaaaatcgaaGATTGTATATACtgtggaaaaagttttccacacaaaatatatttaaaacataaggctgaagaagagaaaaatttaaaatgtcaatactgtgataaatattttgaaactGTTCAACTGTACAGGAGGCATACATACAGGTATCATAAATTATATACATGTAAAATTTGtaatcttaaatttttaaaaggagcCTATGAGTATCACATGAATTCGATGCACAGAACAAAACCAAAATGTAAAGTTTGTCATAAAACATTTGCAACAAAATTGAGTTTGTTagcacatgaaaaaaaaatacatctcGGTTTGAGAGATGAAAGATTCGAATGTCAAATTTGCAAATACAAAGCTCCtgataaatttcaattcgagATACACATATCAAGACATAACAAAGCTCCTTCTTTCGTGTGTGATCAATGTGGGAGTGGACATTATACAAAAACAGAACTTAACAAACACATACAAGCTAATCATTGTGGTGGGTATGTATGcacaatttgtaaaaaaacatttcgaagtCCCGAATatcttaaaaaacatttaatcatTCACAAACCTAATTACGATccgaacgaaataaatttcactTGCGAAGAATGCGgtaaaggttttttaaatcaactcggatttaaaaaacatttatctaAGCATAAAaatgagggaaaattttacaattgtaATATATGTGACAAAAACATAACATcaaaatcatcatttaaaactcATTTGAGAATGCACTCGGGTCGAAAACCATATAACTGCAGTCAAtgcgaaaaaacattttccgataagaaatatttaatagaacatgaaaataatcattcgaaagaaaaaattttcacttgtaATAGAtgcaatgaaaatttttcacattacaaacaattttccaaTCATAAACAATCACATTTGATGTAG
- Protein Sequence
- MVFIHIEFLYEILISGSNQFELIHNQKSRCGNLSFNNKDSKKSVNEKIEDCIYCGKSFPHKIYLKHKAEEEKNLKCQYCDKYFETVQLYRRHTYRYHKLYTCKICNLKFLKGAYEYHMNSMHRTKPKCKVCHKTFATKLSLLAHEKKIHLGLRDERFECQICKYKAPDKFQFEIHISRHNKAPSFVCDQCGSGHYTKTELNKHIQANHCGGYVCTICKKTFRSPEYLKKHLIIHKPNYDPNEINFTCEECGKGFLNQLGFKKHLSKHKNEGKFYNCNICDKNITSKSSFKTHLRMHSGRKPYNCSQCEKTFSDKKYLIEHENNHSKEKIFTCNRCNENFSHYKQFSNHKQSHLM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -