Phum007399.1
Basic Information
- Insect
- Pediculus humanus
- Gene Symbol
- Cebpg_1
- Assembly
- GCA_000006295.1
- Location
- NW:198340-198943[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 4.7 2.6e+03 -2.2 0.4 20 24 10 14 6 18 0.51 2 3 2.7e-16 1.6e-13 49.8 10.4 2 65 20 83 19 83 0.96 3 3 3.1 1.8e+03 -1.7 0.2 43 50 99 106 97 115 0.72
Sequence Information
- Coding Sequence
- atgcCTCCTGGAAATAAAgacaataaaagaaagagaaaggttGAAACCAATCTCAATGATGAAGAATATCGAAGAAAGagggataaaaataatttgGCAGTGAAAAGATCGAgggataaaacaaaacaaagaacAAAACAGACATTAGATAGagtaaatcaattaaaatcggaaaatgaaactttagaggaaaaaattaagcTTCTTACAAAGGAGCttagctttttaaaaaatttgtttttggctCATGCtggttctaATAATGGAATTGATTTAAGAGACATAAATTTAACTGCCTTATTACAGGAAAATGAAGAAGCTTCTTCTGCAGCTCTGaaagaattaataaacaattcaAATCTTGAAGGAAACAAATCATAA
- Protein Sequence
- MPPGNKDNKRKRKVETNLNDEEYRRKRDKNNLAVKRSRDKTKQRTKQTLDRVNQLKSENETLEEKIKLLTKELSFLKNLFLAHAGSNNGIDLRDINLTALLQENEEASSAALKELINNSNLEGNKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01250826;
- 90% Identity
- -
- 80% Identity
- -