Pmau001191.1
Basic Information
- Insect
- Paykullia maculata
- Gene Symbol
- kn_2
- Assembly
- GCA_003055125.1
- Location
- NDXZ01015738.1:1-3154[-]
Transcription Factor Domain
- TF Family
- COE
- Domain
- COE domain
- PFAM
- AnimalTFDB
- TF Group
- Helix-turn-helix
- Description
- This is the helix-loop-helix domain of transcription factor COE. It is responsible for dimerisation [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.5e-51 5.3e-47 160.8 0.1 42 134 8 100 5 100 0.98
Sequence Information
- Coding Sequence
- atgtatgttttgttttatatttctagTTTGGGCATTGGCAGAGCACATTTTGAAAAACAACCGCCcagtaatttaagaaaatcaaattttttccattttgttattgctttgtACGATCGTGCTGGCCAACCCATTGAAATCGAAAGAACTGCATTTATAGGATTTATCGAAAAGGAATCTGAAGCGGATTCAACGAAAACCAATAATGGAATACAATATCGTTTACAGTTACTTTATGCAAAtgGTGCCCGCCAGGAACAGGATATTTTTGTCAGACTTATAGACTCCGTAACGAAACAG
- Protein Sequence
- MYVLFYISSLGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKESEADSTKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- iTF_00749483;
- 80% Identity
- -