Basic Information

Transcription Factor Domain

TF Family: Runt
Domain: Runt domain
PFAM: PF00853
TF Group: Beta-Scaffold Factors
Description: The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.034 2.3e+02 2.5 0.0 11 31 17 37 10 44 0.87

2 6 0.033 2.3e+02 2.5 0.0 11 31 68 88 61 95 0.87

3 6 0.034 2.3e+02 2.5 0.0 11 31 119 139 112 146 0.87

4 6 0.033 2.3e+02 2.5 0.0 11 31 170 190 163 197 0.87

5 6 0.033 2.3e+02 2.5 0.0 11 31 221 241 214 248 0.87

6 6 0.034 2.3e+02 2.5 0.0 11 31 272 292 265 299 0.87

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.034	2.3e+02	2.5	11	31	17	37	10	44	0.87
2	6	0.033	2.3e+02	2.5	11	31	68	88	61	95	0.87
3	6	0.034	2.3e+02	2.5	11	31	119	139	112	146	0.87
4	6	0.033	2.3e+02	2.5	11	31	170	190	163	197	0.87
5	6	0.033	2.3e+02	2.5	11	31	221	241	214	248	0.87
6	6	0.034	2.3e+02	2.5	11	31	272	292	265	299	0.87

Coding Sequence: ATgctcgccgccgcgccgagTGGCCCCACGATTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgagTGGCCCCACGACTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgagTGGCCCCACGATTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgagTGGCCCCACGACTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgagTGGCCCCACGACTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgagTGGCCCCACGATTCATCTCTTCATACCTGGCTTGGTGTCGGTGACGACGGGCAGCACCTTGGCGAGCACGCTGAGCGCGCACTGGCgcagcggcgcgtgcggcgACGCGGCCAGCGGCGCGCACGCGCGCAGGATgctcgccgccgcgccgaCACGCTGA
Protein Sequence: MLAAAPSGPTIHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPSGPTTHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPSGPTIHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPSGPTTHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPSGPTTHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPSGPTIHLFIPGLVSVTTGSTLASTLSAHWRSGACGDAASGAHARRMLAAAPTR

Sequence clustering based on sequence similarity using MMseqs2