Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.067 41 6.3 3.4 5 34 3 28 2 43 0.81

2 10 0.0042 2.6 10.1 5.9 18 38 43 64 28 67 0.87

3 10 0.033 20 7.3 1.6 14 33 67 87 63 93 0.78

4 10 0.038 23 7.1 1.0 17 33 98 115 89 121 0.73

5 10 0.22 1.4e+02 4.6 3.7 5 38 115 148 111 150 0.79

6 10 0.0018 1.1 11.3 0.6 5 38 143 176 141 182 0.85

7 10 0.089 54 5.9 5.9 14 38 179 204 170 211 0.80

8 10 0.058 35 6.5 6.6 11 38 205 232 199 239 0.80

9 10 0.42 2.6e+02 3.7 5.2 14 36 235 254 228 261 0.69

10 10 0.053 32 6.6 4.3 16 30 265 283 255 293 0.70

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.067	41	6.3	3.4	5	34	3	28	2	43	0.81
2	10	0.0042	2.6	10.1	5.9	18	38	43	64	28	67	0.87
3	10	0.033	20	7.3	1.6	14	33	67	87	63	93	0.78
4	10	0.038	23	7.1	1.0	17	33	98	115	89	121	0.73
5	10	0.22	1.4e+02	4.6	3.7	5	38	115	148	111	150	0.79
6	10	0.0018	1.1	11.3	0.6	5	38	143	176	141	182	0.85
7	10	0.089	54	5.9	5.9	14	38	179	204	170	211	0.80
8	10	0.058	35	6.5	6.6	11	38	205	232	199	239	0.80
9	10	0.42	2.6e+02	3.7	5.2	14	36	235	254	228	261	0.69
10	10	0.053	32	6.6	4.3	16	30	265	283	255	293	0.70

Coding Sequence: ATGGTGAATCATGTTAGGAAGCATACTGGTGAAACTCCACATCGTTGTGACATCTGCAAGAAGAGCTTCACCAGGAAAGAACATTTTATGAACCATGTCATGTGGCACACAGGTGAAACGCCGCATCATTGCCAAATATGTGGCAAGAAGTATACTAGGAAGGAGCATTTAGTCAACCATATGAGATCTCATACCAATGACACTCCGTTTCGATGTGAATTGTGCGGCAAGTCATTTACAAGAAAGGAACACTACACCAATCACATACTGTGGCATACGGGTGAAACACCGCACCGGTGCGACTTCTGTTCGAAGACTTTCACGCGCAAGGAGCACCTGCTGAACCACGTGCGGCAGCACACGGGCGAGTCGCCGCatcgctgcagcttctgctccAAGTCCTTCACTCGCCGGGAGCACCTCGTCAACCACGTCAGGCAACACACTGGCGAGACGCCCTTCCAGTGTGGATACTGCCCTAAAGCGTTCACTCGAAAGGATCACTTGGtaaaCCATGTCCGACAACACACTGGAGAATCGCCTCACATATGTTCATATTGTACAAAGTCTTTCACGCGCAAGGAACACTTGACTAATCATGTCCGTCAGCACACGGGAGAGTCGCCGCATCGCTGCACCTATTGCGCTAAATCTTTCACAAGGAAAGAACATCTTACTAACCATATCAGACAGCACACGGGCGAAACTCCACACAAGTGCACGTACTGCTCGCGCGCCTTCTCGCGCAAGGAGCACCTCAACAACCACATCCGGCAGCACACCGGCGACACGCCGCACTCTTGCTCCTATTGCAACAAGACCTTCAAGCGCAAGGAGCACCTCGTCAACCATGTTCGGTTCGTATGGGCACACCTTTGTGGAAGCAATATTAATTAG
Protein Sequence: MVNHVRKHTGETPHRCDICKKSFTRKEHFMNHVMWHTGETPHHCQICGKKYTRKEHLVNHMRSHTNDTPFRCELCGKSFTRKEHYTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSFCSKSFTRREHLVNHVRQHTGETPFQCGYCPKAFTRKDHLVNHVRQHTGESPHICSYCTKSFTRKEHLTNHVRQHTGESPHRCTYCAKSFTRKEHLTNHIRQHTGETPHKCTYCSRAFSRKEHLNNHIRQHTGDTPHSCSYCNKTFKRKEHLVNHVRFVWAHLCGSNIN

Sequence clustering based on sequence similarity using MMseqs2