Porl052166.1
Basic Information
- Insect
- Parnassius orleans
- Gene Symbol
- -
- Assembly
- GCA_029286625.1
- Location
- JAGSMP010000409.1:177326-177985[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.3e-05 0.071 15.1 0.9 25 54 5 34 4 37 0.88 2 2 3.2e-07 0.001 21.0 0.4 21 51 36 66 34 68 0.91
Sequence Information
- Coding Sequence
- ATGGACATAAGAGCTACAAATAACAACATACAAAACTCTATAGACTTTCTTGCATCACAGAATGAGgaactaaaaaagaaaattgagcAGTtggaatttcaaacaaagaaggacaAGGACTATATAACAATACTAGAAGATAAAGTCGAGGATCTACAGCGAGAAAACCAACAACTGACAGCAAGAGGAGCACGCCTATATTTTCTAGCCCGCGATCTTGCCAAGTCTAAGAACTACAAGTTCTGTTGGACGGCCTacggtaaaatatatataagaaaacatgAAAACTCGCCCattatagttattaaaaatgaatctCAAGTTAATAGTCTTATGCAAAATGAATga
- Protein Sequence
- MDIRATNNNIQNSIDFLASQNEELKKKIEQLEFQTKKDKDYITILEDKVEDLQRENQQLTARGARLYFLARDLAKSKNYKFCWTAYGKIYIRKHENSPIIVIKNESQVNSLMQNE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -