Basic Information

Transcription Factor Domain

TF Family: Runt
Domain: Runt domain
PFAM: PF00853
TF Group: Beta-Scaffold Factors
Description: The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1e-17 4.7e-14 52.7 0.5 94 129 1 36 1 36 0.98

2 2 2.2 1e+04 -3.3 0.0 116 127 120 131 117 132 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1e-17	4.7e-14	52.7	0.5	94	129	1	36	1	36	0.98
2	2	2.2	1e+04	-3.3	0.0	116	127	120	131	117	132	0.81

Coding Sequence: AAGTCGTTCACGCTGACGATCACGATATCGACGACGCCGCCGCAGGTCACCACTTACAACAAAGCGATCAAGGTGACGGTGGACGGGCCACGGGAGCCGCGCTCCAAGACCACAACTTGCCAGTTGGTACAAATGGACACTACAGAAACTGTCAAACCAATTAAGTTTTATGATATCGACACACGGATAGCAGCGCGGATATCACAAATATTGTCCGCGCACTCTATACCCTTGTTCAACCGTTTTCTATTTTTACCCATCAGCGGGTGGGTGGCTCGGTTGCCGCGCAGTAGCCGCCACGGTTTAATATTCGGTCGGCTGTTAACGATGTTTTTCTTAAGGCAGCGATGGCTAGTTATTTCGGTAACAAGCCCAGCACCGAGACCACCCGCGCTCTCGCCGTGTTTACATCACGCTTGCGACCAACTTCGTTGTTTACTTCACACGTAA
Protein Sequence: KSFTLTITISTTPPQVTTYNKAIKVTVDGPREPRSKTTTCQLVQMDTTETVKPIKFYDIDTRIAARISQILSAHSIPLFNRFLFLPISGWVARLPRSSRHGLIFGRLLTMFFLRQRWLVISVTSPAPRPPALSPCLHHACDQLRCLLHT

Sequence clustering based on sequence similarity using MMseqs2