Pxut008679.1
Basic Information
- Insect
- Papilio xuthus
- Gene Symbol
- prr1
- Assembly
- GCA_000836235.1
- Location
- NW:28151-29002[-]
Transcription Factor Domain
- TF Family
- HSF
- Domain
- HSF_DNA-bind domain
- PFAM
- PF00447
- TF Group
- Helix-turn-helix
- Description
- Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.2e-34 5.3e-31 106.8 4.4 1 100 9 108 9 108 0.98 2 2 0.45 1.1e+03 -0.1 0.0 6 48 186 227 184 236 0.74
Sequence Information
- Coding Sequence
- atgacattaaaagaaaaaacagattttgtaaaaaaactgtaCAATATTCTAGAAACCCCAGAGTACCACGCCTACATCAGTTGGTCAGATGatggaaaaagttttttaattctagatCCGCAGGAATTTTCAGAGAACGttttaaccaatttttttaGACACAAAAATGTGAGCTCTTTCATTCGCCAATTAAACAAGTACGACTTTCATAAAGTTAAAAGCACTTCGTTTGTATTGGAGAGGTATGGTCCTCAAGTCTTGGAGTTTAAGAATGTACATTTCGAGAGAGGAAACAAGAgtcaattgtttaaaataagacgAAAATCATCGTgtagtgaaattaaattaggaGGAGAGTATCCTGGTGTCGAAAATTCGTTCGTTTTTCAAGATCATGTCGTGTCTTCAATAAGAAATTTAAGCGACAAATTTGAAAGTTTAACGGATCATATCAAAGATATCAAGTCCAAATTATCAGAGTTAATGTACGATGTCTATTCTAAaagaattaatgttttattatttgatgaagatgttaatttatcaatttacatttattcacTTCTCCGCGATCACAATATGTCTATTACTGTTCTTGATTCACAAGGTTCTCTTTATCCCGTTATTAAGCatacaacttttaattttattgtattaagcACAACATTTGAAGTGGCTAATTCTGTGATGGGTTATTTTAGAAGCTTTGATCATATCACACCCGTTATTTACATAGGTTATGAATCTTCTGAGATAGACATTTATTCTCTGGgtgtaaatgattttattaagaagCCATTTTCTCATGCATCTTTCCTATCTATTATTGAGAAATACATCCCTAAGaggtag
- Protein Sequence
- MTLKEKTDFVKKLYNILETPEYHAYISWSDDGKSFLILDPQEFSENVLTNFFRHKNVSSFIRQLNKYDFHKVKSTSFVLERYGPQVLEFKNVHFERGNKSQLFKIRRKSSCSEIKLGGEYPGVENSFVFQDHVVSSIRNLSDKFESLTDHIKDIKSKLSELMYDVYSKRINVLLFDEDVNLSIYIYSLLRDHNMSITVLDSQGSLYPVIKHTTFNFIVLSTTFEVANSVMGYFRSFDHITPVIYIGYESSEIDIYSLGVNDFIKKPFSHASFLSIIEKYIPKR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01149515;
- 90% Identity
- iTF_01149515;
- 80% Identity
- iTF_01149515;