Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.99 4.2e+03 -1.6 1.6 15 19 11 15 10 15 0.82

2 6 0.052 2.2e+02 2.5 0.8 4 10 45 51 43 51 0.91

3 6 1.4e-05 0.058 13.9 18.1 4 19 59 74 57 74 0.93

4 6 1.2e-08 5.2e-05 23.7 13.9 1 19 110 128 110 128 0.98

5 6 2.8e-05 0.12 12.9 9.9 1 19 169 187 169 187 0.98

6 6 2.9 1.2e+04 -3.1 1.5 14 14 197 197 194 200 0.45

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.99	4.2e+03	-1.6	1.6	15	19	11	15	10	15	0.82
2	6	0.052	2.2e+02	2.5	0.8	4	10	45	51	43	51	0.91
3	6	1.4e-05	0.058	13.9	18.1	4	19	59	74	57	74	0.93
4	6	1.2e-08	5.2e-05	23.7	13.9	1	19	110	128	110	128	0.98
5	6	2.8e-05	0.12	12.9	9.9	1	19	169	187	169	187	0.98
6	6	2.9	1.2e+04	-3.1	1.5	14	14	197	197	194	200	0.45

Coding Sequence: ATGAGCAGTTTAGTTGAAGGCAAATGGAGATGCCCGGCATGTCAAAACACGAATGAAGACATCCCAACAGAGTACCGTTGCATGTGCGGTGCTGTTAAATCACCAGAGTACTCACGTGGCTCTGTCAGTGCTCACACTTGTGGCAAGTCATGCCGTCGACCGAGGAATTGTCCACATCCTTGCACTTTGCTCTGCCATCCCGGCCCCTGTCCACCTTGCCAGGCGACTGTCAGCAAACAATGTGGCTGCGGTGCAGAGACTCGTTCTGTGCTATGCAGCAGCAAGCTGGCACAGCTGTGCGGGCGCGAGTGCCGACGCAAGCTGACCTGCGGCGTGCACGAGTGCCAGCGCGAGTGTCACGAGGGTCCATGCGATGAATGCTCCGAAATTGTCACACAAGtgtGCTACTGCCCCGCGGCTAAGACGCGATCAATACCGTGCACGTCGGACACGAGTGGCGAGCACGCGTGGTCGTGCGGTGCGGCGTGCGCACGCGTGCTGTCGTGCGGCGCGCACGTGTGTCGGCGTGTCTGTCACGCCCCGCCCTGCGCGCTCTGCCCCCTGCGCCCCGACAACGTGCACTCCTGCCCCTGCGGCAACACTAA
Protein Sequence: MSSLVEGKWRCPACQNTNEDIPTEYRCMCGAVKSPEYSRGSVSAHTCGKSCRRPRNCPHPCTLLCHPGPCPPCQATVSKQCGCGAETRSVLCSSKLAQLCGRECRRKLTCGVHECQRECHEGPCDECSEIVTQVCYCPAAKTRSIPCTSDTSGEHAWSCGAACARVLSCGAHVCRRVCHAPPCALCPLRPDNVHSCPCGNT

Sequence clustering based on sequence similarity using MMseqs2