Ppol012370.1
Basic Information
- Insect
- Papilio polyxenes
- Gene Symbol
- NFX1_1
- Assembly
- GCA_026167825.1
- Location
- JAOPJD010052396.1:1-1454[+]
Transcription Factor Domain
- TF Family
- zf-NF-X1
- Domain
- zf-NF-X1 domain
- PFAM
- PF01422
- TF Group
- Zinc-Coordinating Group
- Description
- This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 5.2e-08 0.00022 21.7 14.1 1 19 5 27 4 27 0.89 2 6 2.6 1.1e+04 -2.9 0.9 1 4 36 38 36 39 0.79 3 6 1.2 5e+03 -1.9 2.2 6 10 57 61 57 61 0.95 4 6 0.0033 14 6.3 7.3 1 11 67 77 67 78 0.94 5 6 0.014 58 4.3 0.6 4 10 82 88 81 88 0.92 6 6 6.9e-07 0.0029 18.1 14.0 3 19 96 112 94 112 0.92
Sequence Information
- Coding Sequence
- AAGCCGTTGCCCTGCGGTCCGGAGGGAGATAAACACTTTTGTAAACAATTGTGTCATGAAGGTCCATGTCCAACATGTCCTGACAAGACTCTGTTACCATGCCGTTGTGGTCACTCGAGCCGGGAGGTGCCATGCTCAGACTTGCCCGACATGCTCAACAATGTCTTCTGCCAGAAGAAATGTAACAAGAAGTTGTCTTGCGGTCGCCACCGTTGTCGTACTGCGTGCTGCGCTGCGCAGTCGCACCGTTGCGCAGTGGTGTGCGGGCGCACTCTCTCCTGTCAGCTCCACCGCTGTGAGGAGTTCTGTCACACCGGACACTGCGCACCCTGCCCTCGCGTCAGTAAGtcatcatcatcagctatacttccccactga
- Protein Sequence
- KPLPCGPEGDKHFCKQLCHEGPCPTCPDKTLLPCRCGHSSREVPCSDLPDMLNNVFCQKKCNKKLSCGRHRCRTACCAAQSHRCAVVCGRTLSCQLHRCEEFCHTGHCAPCPRVSKSSSSAILPH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -