Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 5.2e-08 0.00022 21.7 14.1 1 19 5 27 4 27 0.89

2 6 2.6 1.1e+04 -2.9 0.9 1 4 36 38 36 39 0.79

3 6 1.2 5e+03 -1.9 2.2 6 10 57 61 57 61 0.95

4 6 0.0033 14 6.3 7.3 1 11 67 77 67 78 0.94

5 6 0.014 58 4.3 0.6 4 10 82 88 81 88 0.92

6 6 6.9e-07 0.0029 18.1 14.0 3 19 96 112 94 112 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	5.2e-08	0.00022	21.7	14.1	1	19	5	27	4	27	0.89
2	6	2.6	1.1e+04	-2.9	0.9	1	4	36	38	36	39	0.79
3	6	1.2	5e+03	-1.9	2.2	6	10	57	61	57	61	0.95
4	6	0.0033	14	6.3	7.3	1	11	67	77	67	78	0.94
5	6	0.014	58	4.3	0.6	4	10	82	88	81	88	0.92
6	6	6.9e-07	0.0029	18.1	14.0	3	19	96	112	94	112	0.92

Coding Sequence: AAGCCGTTGCCCTGCGGTCCGGAGGGAGATAAACACTTTTGTAAACAATTGTGTCATGAAGGTCCATGTCCAACATGTCCTGACAAGACTCTGTTACCATGCCGTTGTGGTCACTCGAGCCGGGAGGTGCCATGCTCAGACTTGCCCGACATGCTCAACAATGTCTTCTGCCAGAAGAAATGTAACAAGAAGTTGTCTTGCGGTCGCCACCGTTGTCGTACTGCGTGCTGCGCTGCGCAGTCGCACCGTTGCGCAGTGGTGTGCGGGCGCACTCTCTCCTGTCAGCTCCACCGCTGTGAGGAGTTCTGTCACACCGGACACTGCGCACCCTGCCCTCGCGTCAGTAAGtcatcatcatcagctatacttccccactga
Protein Sequence: KPLPCGPEGDKHFCKQLCHEGPCPTCPDKTLLPCRCGHSSREVPCSDLPDMLNNVFCQKKCNKKLSCGRHRCRTACCAAQSHRCAVVCGRTLSCQLHRCEEFCHTGHCAPCPRVSKSSSSAILPH

Sequence clustering based on sequence similarity using MMseqs2