Pphe035433.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Papilio phestus
Gene Symbol
zfh1
Assembly
GCA_018231625.1
Location
DVQH01043233.1:1208-2185[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 6 0.02 2.4 10.3 1.7 1 20 157 176 157 178 0.92
2 6 1.2e-05 0.0015 20.4 1.2 1 23 187 209 187 209 0.98
3 6 0.13 16 7.7 4.8 3 23 221 240 220 240 0.98
4 6 1.1e-06 0.00013 23.7 2.2 1 23 246 268 246 268 0.97
5 6 1.5e-06 0.00018 23.3 1.7 1 23 274 296 274 296 0.96
6 6 2.4e-07 2.8e-05 25.8 1.3 1 23 302 324 302 324 0.98

Sequence Information

Coding Sequence
AATATGCAGAACAACCCCCAGGAGCTTTCATGGCAGGCGATCCAGGCTATCGTGGGGGTTAAACTACCTCCGAATGTGTTACGATTCGACGATATTGGGTTCCATTTAGTCAATAATTCGGCGTCTAGTGCCGAAGATTCGGATTCAGATGTGGAAATCGTTGAAAATGAATGGGAATCGGACAACAATATTTCATCTAAGCCTGAAAACTCTGATAATGAGAAAACTACGCCCGATAGAGAACAAAGCGAGTCTCCCGTCCTTCATCTCGTGGAGCCCGATAACAACAATTCGGACAAAGCTTCTTTAGATTACAGAGactatttaatgaaaatggaTACCAAAGATAACTCAGATATAGACCAAATGATACAATCACATATAGATGATGCGGATAGTTCTATTGGGAATGTCTTGTCAATTGAGAACTACTTAGAGGTAACTTTGTCAACGGACTCCGAGGCTAGTCATACATGTAGCCGGTGTAATCAGATATTCTCCAGTGAACAGTTGCTTTCCGCACACGAGTGTAGCGCTAAACCCACCGAAGAGAAGAAATACCCATGTCACATGTGCTCGGAAAAGTTTCCAAGCTATTGGGAGCTGAGAAAGCATATAAACAGTCATTTTCCAGGAATGTTAGACTCTAAATCAAGTTTCTGCCACCTTTGCCAGAAGGATTACACAAAGACGGGCTTCATGAATCATCTCCGGAAGCATACAGGAGAAAGGCCTTTTGTTTGTGAACTTTGCCACAAAGCGTTCTCACAGTCGAGTTCTCTGTCGATTCATATGAAGTTCCACCTGAACGTGCGTAAACATGCGTGCACAGTTTGTGAGAAGAAGTTTGTAACAAAAAGTGAACTATCACGTCACATGACTGTgcacacaaaacaaaagtctTACTACTGCGGGGTGTGTGATAAGGCTTTCACTCGCTCTGATAACATGAAGAAGCATGAAAAAACACATGGTTGA
Protein Sequence
NMQNNPQELSWQAIQAIVGVKLPPNVLRFDDIGFHLVNNSASSAEDSDSDVEIVENEWESDNNISSKPENSDNEKTTPDREQSESPVLHLVEPDNNNSDKASLDYRDYLMKMDTKDNSDIDQMIQSHIDDADSSIGNVLSIENYLEVTLSTDSEASHTCSRCNQIFSSEQLLSAHECSAKPTEEKKYPCHMCSEKFPSYWELRKHINSHFPGMLDSKSSFCHLCQKDYTKTGFMNHLRKHTGERPFVCELCHKAFSQSSSLSIHMKFHLNVRKHACTVCEKKFVTKSELSRHMTVHTKQKSYYCGVCDKAFTRSDNMKKHEKTHG