Basic Information

Insect: Papilio helenus
Gene Symbol: -
Assembly: GCA_026546675.1
Location: JAOCNA010000007.1:3640498-3648844[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 13 0.03 5.4 8.9 1.2 9 23 2 16 1 16 0.95

2 13 6.6e-05 0.012 17.3 0.6 1 23 31 53 31 53 0.98

3 13 2.1e-05 0.0037 18.8 3.1 1 23 68 90 68 90 0.98

4 13 9.4e-06 0.0017 19.9 0.8 1 23 105 127 105 127 0.99

5 13 6.4e-05 0.011 17.3 2.8 1 23 133 155 133 155 0.98

6 13 4.6e-06 0.00081 20.9 2.1 1 23 161 183 161 183 0.99

7 13 0.015 2.6 9.9 1.8 1 23 190 212 190 212 0.98

8 13 2.5e-07 4.4e-05 24.9 2.3 1 23 218 240 218 240 0.99

9 13 0.017 3 9.7 1.8 1 23 247 269 247 269 0.98

10 13 1e-06 0.00018 23.0 1.5 1 23 275 297 275 297 0.99

11 13 0.00081 0.14 13.8 0.3 1 20 303 322 303 325 0.93

12 13 2e-05 0.0035 18.9 1.3 2 23 332 353 331 353 0.96

13 13 1.4e-06 0.00025 22.5 1.4 1 23 359 382 359 382 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	13	0.03	5.4	8.9	1.2	9	23	2	16	1	16	0.95
2	13	6.6e-05	0.012	17.3	0.6	1	23	31	53	31	53	0.98
3	13	2.1e-05	0.0037	18.8	3.1	1	23	68	90	68	90	0.98
4	13	9.4e-06	0.0017	19.9	0.8	1	23	105	127	105	127	0.99
5	13	6.4e-05	0.011	17.3	2.8	1	23	133	155	133	155	0.98
6	13	4.6e-06	0.00081	20.9	2.1	1	23	161	183	161	183	0.99
7	13	0.015	2.6	9.9	1.8	1	23	190	212	190	212	0.98
8	13	2.5e-07	4.4e-05	24.9	2.3	1	23	218	240	218	240	0.99
9	13	0.017	3	9.7	1.8	1	23	247	269	247	269	0.98
10	13	1e-06	0.00018	23.0	1.5	1	23	275	297	275	297	0.99
11	13	0.00081	0.14	13.8	0.3	1	20	303	322	303	325	0.93
12	13	2e-05	0.0035	18.9	1.3	2	23	332	353	331	353	0.96
13	13	1.4e-06	0.00025	22.5	1.4	1	23	359	382	359	382	0.97

Sequence Information

Coding Sequence: atgcgcttcacgcagagctccagcctcaaccgacacaagaaaatacacacggAGGAACACAAACGCGCGCTGCTGGCTAAGCACCGCCCCTACCAGTGCGGCGTCTGCTTTGTGCGATTCACCCAGAAATCGAGTTTGGGCCGGCACGGGAAGATACATACCGAGGAGCACAGACGAGCCCTGTTAGAGAAAGTgcggccgtaccagtgccacatctgttttatgcgcttcacacagaaatccagcctgggccgacacggaaagatacataccgAGGAGCACATCCAATCGCTGATCAACAAAGTgcgcccctatcagtgcgacatctgtgacaagtggttcacgcagaagtccagcctgggcactcataaacgcatacacaccggcgagcggccgttccagtgcaccgtctgcctcaagtccttcacgcagaagtgcgcgctcaatttgcacgaaaagatacatacgggcgagcggccctatcagtgcgacgcctgtctcaagcgcttcacgcagaagtccagcctcaatatacataaacggacgcacacagtccagggcagaccgttccagtgcctgtcgtgccccgccgccttcacctgcaagcaatacttggagatacacacgcgcacgcacaccggcgagcgaccgtatcagtgcgacatctgcctgaagcgcttcacgcagaagtccagtctcaacatccacaaacgaacgcactcagtgcagggccggcccttccagtgcctgcagtgccccgccgccttcacctgcaagcagtacctcgagatacacaaccgcacgcacaccggcgagcggccctaccagtgcgacgtctgcctcaagagattcgctcaaaagtcaacactcaatatacacaaacgaacgcacacagGTGAACGTCCATATGCATGTGATATATGTCAGAAACGATTTGCTGTGAAGAGTTATGTAACAGCGCATAGATGGTCGCACGTGGCGGACAAGCCGTTGAACTGTGACCGGTGCTCGCTGACCTTCACCTCCAAGTCCCAGTTCGCGCTGCACATCCGCACGCACTCCGCCGCCGCCTGCTACGAGTGCAGCGTCTGCGGACGTACCTTCGTGCGCGACAGCTATCTCATACGGCATCACAACCGCGTGCACCGCGACAACCACAGCAACATGTCGGCGAACAGCATCGGCAACATGGCCGCCAACGCCAACAACTCTAACAATTTCGACACCTCCGGCGTTTGTGACTTAAGTTTCGTGCCGATGGTGAACCGCTACATGACGTCGCAGGGCACGCAGGTGTCGATGCAGGACGCCAGCAAGATGTCCGCCATGTCGCCGCAGTCCATCGCCTCCATATGCATGCAGTGTACATTGCCCGCTATGTACTCCTCACGAGCGCCCGGCCGCTTGCAAGCCCGCAATGCATACGCTCCGATGGACGCCGATTAA
Protein Sequence: MRFTQSSSLNRHKKIHTEEHKRALLAKHRPYQCGVCFVRFTQKSSLGRHGKIHTEEHRRALLEKVRPYQCHICFMRFTQKSSLGRHGKIHTEEHIQSLINKVRPYQCDICDKWFTQKSSLGTHKRIHTGERPFQCTVCLKSFTQKCALNLHEKIHTGERPYQCDACLKRFTQKSSLNIHKRTHTVQGRPFQCLSCPAAFTCKQYLEIHTRTHTGERPYQCDICLKRFTQKSSLNIHKRTHSVQGRPFQCLQCPAAFTCKQYLEIHNRTHTGERPYQCDVCLKRFAQKSTLNIHKRTHTGERPYACDICQKRFAVKSYVTAHRWSHVADKPLNCDRCSLTFTSKSQFALHIRTHSAAACYECSVCGRTFVRDSYLIRHHNRVHRDNHSNMSANSIGNMAANANNSNNFDTSGVCDLSFVPMVNRYMTSQGTQVSMQDASKMSAMSPQSIASICMQCTLPAMYSSRAPGRLQARNAYAPMDAD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -