Pgla011010.1
Basic Information
- Insect
- Papilio glaucus
- Gene Symbol
- HLF_2
- Assembly
- None
- Location
- scaffold:7282-8220[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.1e-14 1.7e-11 43.8 11.2 1 63 12 74 12 75 0.96
Sequence Information
- Coding Sequence
- AGAGGAGAGAAGAGGCCGATACCGGCGGAGCTGAAAGATGAGAAGTACTTCGAGAGGAGACGTCGCAACAACCAGGCGGCGAAGAAGTCCAGAGATGCTAGGAGGGTGAGAGAAGATCAGATCGCGTGGCGCGCCTGCTACCTCGAGCAGGAGAATGCGTCGTTGCGGGCGCACGTCGCAGCGCTACGACAGGAGGCACTCACGCTGCGCGCACTGCTCGCTCAGCCACCGCACGACCAAGCGCGCAGTGCTCACAATGCGCATACGCACTGCGCACTAGACGCACTGCTTGTTCGCTCCCCGGGACAAGCGCACAATGCGCGTGCGCACTGCACGCTCGATGCACACGGCGCGCCAACTTCAACTACAGCTGATTAA
- Protein Sequence
- RGEKRPIPAELKDEKYFERRRRNNQAAKKSRDARRVREDQIAWRACYLEQENASLRAHVAALRQEALTLRALLAQPPHDQARSAHNAHTHCALDALLVRSPGQAHNARAHCTLDAHGAPTSTTAD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -