Pelw019533.1
Basic Information
- Insect
- Papilio elwesi
- Gene Symbol
- MYB3R5
- Assembly
- GCA_029641285.1
- Location
- CM056365.1:5543140-5543526[-]
Transcription Factor Domain
- TF Family
- MYB
- Domain
- Myb_DNA-binding domain
- PFAM
- PF00249
- TF Group
- Helix-turn-helix
- Description
- This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.0013 1.3 9.7 0.0 30 44 3 17 1 19 0.87 2 3 1e-17 9.7e-15 54.9 0.2 1 46 24 70 24 70 0.97 3 3 3.3e-17 3.2e-14 53.2 0.7 2 43 77 118 76 119 0.98
Sequence Information
- Coding Sequence
- ATGgctttagaaaataaaactttagaaCAATGTAAAgatcgatataaaaaaatagtaaaagtctataaaaaaggaaaatggaCTAAAGAAGAAGATGAGATACTAAAAgatgtttgtaataaatttaaagataaaaattgggTCTTCATATCAACTTTTGTTCCTAATAGAAGTGATGTACAATGTAGAGAAAGGTATATGAATACACTTAAACCTGGACTTAAGTTAGGGAAGTGGAGTGAAgaagaagataaaaaattaatagaaatagtgaaagaaaaaggaaagaaaTGGTCAATTGTATCTGAAATAATGGAGAGTAGGACGGATTCACAATGTAGGAAAAGATATatgatactaaataaaaaagaaaatggtttGGAATAG
- Protein Sequence
- MALENKTLEQCKDRYKKIVKVYKKGKWTKEEDEILKDVCNKFKDKNWVFISTFVPNRSDVQCRERYMNTLKPGLKLGKWSEEEDKKLIEIVKEKGKKWSIVSEIMESRTDSQCRKRYMILNKKENGLE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -