Basic Information

Insect: Panorpa germanica
Gene Symbol: -
Assembly: GCA_963678705.1
Location: OY783216.1:2324077-2325021[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0003 0.019 16.4 0.2 1 20 15 34 15 36 0.95

2 10 0.28 18 7.1 0.2 5 21 46 62 35 63 0.87

3 10 0.0017 0.11 14.0 2.1 1 23 80 102 80 102 0.95

4 10 0.0055 0.35 12.4 0.6 1 20 107 126 107 128 0.94

5 10 0.13 8.7 8.0 0.0 5 21 139 155 136 156 0.93

6 10 0.0037 0.24 13.0 4.5 2 23 174 195 173 195 0.95

7 10 0.0016 0.1 14.1 0.3 2 23 201 223 200 223 0.95

8 10 2.9e-08 1.9e-06 29.0 2.5 1 23 228 250 228 250 0.99

9 10 0.00024 0.015 16.7 1.1 1 23 263 285 263 285 0.97

10 10 0.001 0.065 14.7 3.3 1 23 291 313 291 313 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0003	0.019	16.4	0.2	1	20	15	34	15	36	0.95
2	10	0.28	18	7.1	0.2	5	21	46	62	35	63	0.87
3	10	0.0017	0.11	14.0	2.1	1	23	80	102	80	102	0.95
4	10	0.0055	0.35	12.4	0.6	1	20	107	126	107	128	0.94
5	10	0.13	8.7	8.0	0.0	5	21	139	155	136	156	0.93
6	10	0.0037	0.24	13.0	4.5	2	23	174	195	173	195	0.95
7	10	0.0016	0.1	14.1	0.3	2	23	201	223	200	223	0.95
8	10	2.9e-08	1.9e-06	29.0	2.5	1	23	228	250	228	250	0.99
9	10	0.00024	0.015	16.7	1.1	1	23	263	285	263	285	0.97
10	10	0.001	0.065	14.7	3.3	1	23	291	313	291	313	0.99

Sequence Information

Coding Sequence: ATGTATCTTACGGCTCATTTGACAAATCATTCCAAAGCAATATATGAATGTAAGAAATGTGGTAAAATCTACAAATCGGAAGAACCTTTAGCTAAGCATTTACATTTTTGCAAGTCTTTTGAAGGAGACATTACCAACTGTAATCGAAAATTTCAAACTGACGCAGAGTTAAAGGAGCACTTAAAGATTTGCAAAACTCCCAGCGATTCTCCTAAAAATTGCAACAGTATGAAGCCTTTCTGTTGTAAATCATGCGACAGCACATTTGCATCGAGATCATATCTAGCACAACATATAGTGAATCATTTACAAGAACGCTTCCATTGCGATAAATgtgataaattattaaaaacgcaAGAATCTTTAGATCGACATTTAGAAGAATGTCAACGTATGGATGAAGGTGATATTACAGATTGTAAtcgaaaatttcaaaattatgaaGAGCTAGGCAGACATTTAAAGCTCTGCAAGAATGTTAGTGATTCCCCAAAAAATTGTACAAGTGTGAAGCCTTTATGCTGTAAGCTATGTGACAGCCGGTTTTCCCAAAAGAAGCATCTTATTCAACATGCATCGGTACACGGTGAAAAGAAACTGGAATGCGCGACATGTGGTTTAAAATACCGACATGCAGCTGGGTTGTGGAGACATGAACAACGCACTCATGTTGGTAAACTATACCAATGTTTAAAATGTGATAAAAGTTATGTTAGGTCGGAAAATTTGAAGAAGCATATGAAGACTCATGACAAAGAAGTAATCACAAAGAAACATCGAAACAAGTACGCTTGTGGTCTTTGTGATGCATCTTATTCGAAATGCTCGGATTTAAGAACACATTTAATGCAGCATGCGCGAGGTAAATTATTCCgttgtaaaatatgtaacaaaTCTCACCACAACGCTGATTTGCTTGTTATTCATATGCGGTCACATCCATAG
Protein Sequence: MYLTAHLTNHSKAIYECKKCGKIYKSEEPLAKHLHFCKSFEGDITNCNRKFQTDAELKEHLKICKTPSDSPKNCNSMKPFCCKSCDSTFASRSYLAQHIVNHLQERFHCDKCDKLLKTQESLDRHLEECQRMDEGDITDCNRKFQNYEELGRHLKLCKNVSDSPKNCTSVKPLCCKLCDSRFSQKKHLIQHASVHGEKKLECATCGLKYRHAAGLWRHEQRTHVGKLYQCLKCDKSYVRSENLKKHMKTHDKEVITKKHRNKYACGLCDASYSKCSDLRTHLMQHARGKLFRCKICNKSHHNADLLVIHMRSHP

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -