Pger002336.1
Basic Information
- Insect
- Panorpa germanica
- Gene Symbol
- kn_2
- Assembly
- GCA_963678705.1
- Location
- OY783203.1:13093598-13101864[-]
Transcription Factor Domain
- TF Family
- COE
- Domain
- COE domain
- PFAM
- AnimalTFDB
- TF Group
- Helix-turn-helix
- Description
- This is the helix-loop-helix domain of transcription factor COE. It is responsible for dimerisation [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.4e-52 3.2e-48 165.5 0.1 43 134 7 98 4 100 0.98
Sequence Information
- Coding Sequence
- atgttattatttattgacaGTGTGGGAATTGGCAGAGCTCACTTCGAGAAACAACCTCCTAGCAATTTAAGAAAAagcaatttttttcattttgttatcGCTCTTTACGATCGTGCTGGCCAACCTGTAGAAATTGAAAGGACTGCTTTTATTGGATTCATTGAAAAGGAACAGgaAAGTGAAGGACAAAAAACAAATAATGGAATACAATACAGACTTCAATTGTTATATGCAAATGGTGTTCGACAGGAACAAGATATATTCGTGCGACTCATAGACTCGGTTACAAAACAGGTAAgctaa
- Protein Sequence
- MLLFIDSVGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPVEIERTAFIGFIEKEQESEGQKTNNGIQYRLQLLYANGVRQEQDIFVRLIDSVTKQVS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -