Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.7e-05 0.024 14.8 0.7 15 43 2 27 1 28 0.94

2 9 4.4 6e+03 -2.4 0.1 18 36 30 50 29 51 0.75

3 9 0.0038 5.2 7.4 0.6 15 44 62 88 56 88 0.85

4 9 0.01 14 6.0 0.1 18 43 122 144 119 145 0.90

5 9 0.0016 2.1 8.6 2.3 18 43 151 172 148 173 0.89

6 9 0.19 2.6e+02 1.9 2.2 17 39 177 196 174 197 0.75

7 9 0.00053 0.72 10.1 1.3 2 38 191 227 190 231 0.83

8 9 0.0024 3.3 8.0 0.6 16 38 233 255 223 255 0.83

9 9 0.083 1.1e+02 3.1 0.2 19 41 263 282 258 284 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.7e-05	0.024	14.8	0.7	15	43	2	27	1	28	0.94
2	9	4.4	6e+03	-2.4	0.1	18	36	30	50	29	51	0.75
3	9	0.0038	5.2	7.4	0.6	15	44	62	88	56	88	0.85
4	9	0.01	14	6.0	0.1	18	43	122	144	119	145	0.90
5	9	0.0016	2.1	8.6	2.3	18	43	151	172	148	173	0.89
6	9	0.19	2.6e+02	1.9	2.2	17	39	177	196	174	197	0.75
7	9	0.00053	0.72	10.1	1.3	2	38	191	227	190	231	0.83
8	9	0.0024	3.3	8.0	0.6	16	38	233	255	223	255	0.83
9	9	0.083	1.1e+02	3.1	0.2	19	41	263	282	258	284	0.80

Coding Sequence: ATGAAGAAAGTTCAATGTCCATTTTGTAGACGAGAAATATCCTCACAAAATAGACTTGCTCAACATTTGAAAGCAAATCATACATTCCGATGTGTACCCTGCAACGTTGAGTTTACACATAAGAAAGATCTCAACGCACACAGACTAATCAATCCGAGTTGTTGTGAGATGGAAGAGCCCCAGGAGAAGTTTAGTTGTTCAATGTGTAGTTACAAAGTAACCATTAAACGAAATTTGATTCTTCATATCAAACGAAAACATACGGAAGAAGTAAACATCTTATGTCCAGAATGTGGTCGGGGATTTTTCAATGTAAAAGAATTAGAAGCTCACAAAATTGAAAGCCATGGTGCCGAACCCTTTGTTTGTATACCTTGTAATAAGAACTTCTCTAAAGTTGAAAACTTTCGTCTTCATCAGAGACGATATCATTTGGGAACTGTCAATAAAGAATGTAAAATTTGTCATAAAGTGCTCCGAACAGCTCGACTAAGTGAACATATGAAGCAAGTCCATTACGCCAAAGTGTATGATTGCCATATTTGCAACAAGACTGTTGTCACGGAGAAGAATTACAAGAAACATATGCAGTTACATAGCGACGACAAACCATTTGAGTGTCAATTTTGTCGCAAAgctttcaaattgaaatattatttgacgTTACATTTGCGCACGCACACTGGCGTCCGACCTATGTTCGAATGTGATATTTGTCATAAAGTTCTGCCCACAGATAATCGGACGAAACATATGGCGTTGCATAACGTTCTCAAAACGTCACTGTGTAATGTGTGTGGAGCGGGATTTGTCAATGATGTTGGGTTGAAGGTGCACATGAGACGTCATATTTGA
Protein Sequence: MKKVQCPFCRREISSQNRLAQHLKANHTFRCVPCNVEFTHKKDLNAHRLINPSCCEMEEPQEKFSCSMCSYKVTIKRNLILHIKRKHTEEVNILCPECGRGFFNVKELEAHKIESHGAEPFVCIPCNKNFSKVENFRLHQRRYHLGTVNKECKICHKVLRTARLSEHMKQVHYAKVYDCHICNKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLPTDNRTKHMALHNVLKTSLCNVCGAGFVNDVGLKVHMRRHI

Sequence clustering based on sequence similarity using MMseqs2