Oere016165.1
Basic Information
- Insect
- Osmoderma eremita
- Gene Symbol
- -
- Assembly
- GCA_031763485.1
- Location
- JARFOC010003996.1:46-384[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4.9e-07 0.0018 20.5 4.5 26 57 52 83 43 90 0.59 2 2 0.03 1.1e+02 5.2 0.1 21 39 85 103 84 106 0.90
Sequence Information
- Coding Sequence
- ATGAACGACGCACTGTTGACAATATTTATCACGCTGGGCACCGGGTTGGCCGCGGCTTTTTCCGGCTGGTTTTTCGGCCGGAAAAAACAGAATATCGAAACCATTGATATGGCGCTTGGCACTTGGCAAAAGGTGGTGGATCAGCTTGAAAGGCGCGTCGATGTGCTTTTGAAAAAAGTTGACCAATTGCAAAGCGAAAACGCCGAACTCCGCGACGAAGTGGTGAAGCTCCGCGCGGAAATTATGGAATCGAAACGCAACCGGACAAAGATAGATAATCTCGAAAAAAAAATAGCCCGCTATGAAAAATTACTCACTGATAACGGTATTGATTATTAG
- Protein Sequence
- MNDALLTIFITLGTGLAAAFSGWFFGRKKQNIETIDMALGTWQKVVDQLERRVDVLLKKVDQLQSENAELRDEVVKLRAEIMESKRNRTKIDNLEKKIARYEKLLTDNGIDY
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -