Basic Information

Insect: Orius laevigatus
Gene Symbol: -
Assembly: GCA_018703685.1
Location: JAGWEN010001007.1:29711-30828[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.036 2.2 8.9 0.0 1 23 16 38 16 38 0.97

2 8 0.011 0.65 10.6 0.7 1 23 74 96 74 96 0.98

3 8 0.00016 0.0094 16.4 5.4 2 23 103 124 102 124 0.97

4 8 0.0068 0.41 11.2 0.8 1 20 130 149 130 151 0.91

5 8 0.011 0.65 10.6 0.9 1 20 159 178 159 179 0.96

6 8 0.63 38 5.0 0.4 9 23 197 211 196 211 0.90

7 8 0.85 51 4.6 0.4 11 23 232 244 227 244 0.81

8 8 0.0001 0.0061 17.0 0.7 1 22 248 269 248 269 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.036	2.2	8.9	0.0	1	23	16	38	16	38	0.97
2	8	0.011	0.65	10.6	0.7	1	23	74	96	74	96	0.98
3	8	0.00016	0.0094	16.4	5.4	2	23	103	124	102	124	0.97
4	8	0.0068	0.41	11.2	0.8	1	20	130	149	130	151	0.91
5	8	0.011	0.65	10.6	0.9	1	20	159	178	159	179	0.96
6	8	0.63	38	5.0	0.4	9	23	197	211	196	211	0.90
7	8	0.85	51	4.6	0.4	11	23	232	244	227	244	0.81
8	8	0.0001	0.0061	17.0	0.7	1	22	248	269	248	269	0.96

Sequence Information

Coding Sequence: ATGGACCTTGTCGAAGAGACTGTTGGTTGCCATCAAGAAGATTCATTTTCCTGCGACCTCTGCGAATTTAGGGCGAACAGCGAGCCAGGGCTGAAAGCTCATATCGTCACTCATTTCGACGAAGAAGTCAAAACGTTTTCGTGCGATTTATGCGACTTTTCCTCTCTCGAAGAAATCGCGATCACATCAAAAAACTGCCATCGGAAAACGAGAAAGGTTTATTCGTGTGACTCTTGCGATTTCGAAACTAGCGTCATCCGTCAGTTGAATCGCCATGCTAAGAAACATCTGAAAGAGAATTCGACGAAGTGCACATTTTGCGGTTTGAAGTGTAAAACGAAGTACACTTTAAGGCGCCACGAGCGTGTTCATACCGGAGAGAAGCCTTTCTCATGCGAAAGCTGCGGAACTAAATTTTCACAAAACGGCCATAGGTTGGAACATGAGAAATTGTGTTCGAGCGGCGACGGTTCTTACACTTGCGCCACTTGTTTTTATTCGACTCGAAGCGAACAAAACCTTCGATCTCATTTATATTTTCCATTCGATCGAAGACAAAAGTTGTCGTTCTACAAAGCGAAAATCGAAAAGTGTACATCAGCCGAAAATTTGAAACATCATGAAACGACGCATACGGAGGAGAAAACATCTAAAGAACAAGACCTCTTCTCCGGTTCTTGCTGTTTTACGACTACCAACGGCTGGAATATGAAGCGACATCAAAAAACGCACAGAAACGCCTTCGAATGTGGAAACTGCGGCGTCCAGTTTACTCAAGGCGACCATTTGAAACAACATAGAAGACGATGCGGAACGGACGACTTTTTATGGTTTTCGTGCAGTTTGTGCGAATTTAAATGTGACTACTACAGTCCGGCGAAGGCCGACCATATAATGTCTCACATCGAACAGACATAA
Protein Sequence: MDLVEETVGCHQEDSFSCDLCEFRANSEPGLKAHIVTHFDEEVKTFSCDLCDFSSLEEIAITSKNCHRKTRKVYSCDSCDFETSVIRQLNRHAKKHLKENSTKCTFCGLKCKTKYTLRRHERVHTGEKPFSCESCGTKFSQNGHRLEHEKLCSSGDGSYTCATCFYSTRSEQNLRSHLYFPFDRRQKLSFYKAKIEKCTSAENLKHHETTHTEEKTSKEQDLFSGSCCFTTTNGWNMKRHQKTHRNAFECGNCGVQFTQGDHLKQHRRRCGTDDFLWFSCSLCEFKCDYYSPAKADHIMSHIEQT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -