Basic Information

Insect: Orchestes rusci
Gene Symbol: -
Assembly: GCA_958502075.1
Location: OY293311.1:1807409-1808509[-]

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.034 63 5.3 0.8 18 44 44 67 36 67 0.89

2 11 0.16 2.9e+02 3.2 0.1 17 29 72 84 68 96 0.69

3 11 0.02 36 6.1 0.6 19 44 104 126 100 126 0.92

4 11 0.003 5.5 8.7 2.2 16 43 131 155 128 156 0.91

5 11 0.01 18 7.0 1.4 14 44 159 186 154 186 0.86

6 11 0.0095 17 7.1 0.3 11 44 186 216 183 216 0.85

7 11 0.00013 0.23 13.1 0.9 11 44 216 246 213 246 0.86

8 11 0.00011 0.2 13.3 0.6 10 44 245 276 243 276 0.89

9 11 0.079 1.5e+02 4.1 0.3 18 43 283 305 279 306 0.81

10 11 0.042 76 5.0 1.7 12 43 307 335 295 338 0.71

11 11 0.00028 0.51 12.0 3.5 11 44 336 366 329 366 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.034	63	5.3	0.8	18	44	44	67	36	67	0.89
2	11	0.16	2.9e+02	3.2	0.1	17	29	72	84	68	96	0.69
3	11	0.02	36	6.1	0.6	19	44	104	126	100	126	0.92
4	11	0.003	5.5	8.7	2.2	16	43	131	155	128	156	0.91
5	11	0.01	18	7.0	1.4	14	44	159	186	154	186	0.86
6	11	0.0095	17	7.1	0.3	11	44	186	216	183	216	0.85
7	11	0.00013	0.23	13.1	0.9	11	44	216	246	213	246	0.86
8	11	0.00011	0.2	13.3	0.6	10	44	245	276	243	276	0.89
9	11	0.079	1.5e+02	4.1	0.3	18	43	283	305	279	306	0.81
10	11	0.042	76	5.0	1.7	12	43	307	335	295	338	0.71
11	11	0.00028	0.51	12.0	3.5	11	44	336	366	329	366	0.87

Sequence Information

Coding Sequence: ATGTGTGAAGAAACCCAAAATATCCTGaaagacatcaaagaagaagaatcaCTTGACATTAAAGAAGATACAATGGACTTGGCTGATGAAACGCAGCTCGAAGAAATCCTCAGCCACCATGAAGGATTCaagtgtgatttttgtgataaatctttcaagttcaacaaaattcttatcaatcaTATCAACACAGTCCACTCAATCAAGGAAAGTTTCAACTGTGAATTTTGCGAAAGGACTTTCAAGGACAAGGACTACTTGGAAGACCACGTTAAAAGACTACATCAGTCTGCTGTTGAATTATCACATTGCGAGTTTTGTGACAAATATTTCAAGGATATAGACAGTTTTAGGAGACATGTCAATTGTCAACATTCCGAAGCTTTCGAGAAAATAACTTGTGATTTTTGCCTAAAGTCTTTCAAGAATCAAGGCAATCTCAAAAGACATATTAAAATACATCATTCAAGCAGTGATGAAAGTTTCAATTGTGAattttgcgataagactttcaaggcAAAAGACTACTTGGAAAAGCATGTTAAAAGACAACATCAGCGCATTTTAAAACTATTACaatgcgagttttgtgacaagtctTTTAAGGATAAAGACGCTTTTAGGAGACATGTCAGATTTCAACATTCAGAAGCTTCCGAGAGAGTTActtgtgatttttgccaaaagtCTTTTAAGAGGAAAAGCAATCTTGATCTTCATGTTAGATTACGACACTCAACCAGTGATGAGAATTACACGTGTGAATTTTGCGGCAAGACTTTCAAGGCGAAAGACTATTTGGAAAAGCATGTTAAAAGACAACATCCGCCCATTTTGGAACTATTACaatgcgagttttgtgacaagtctTTTAAATATAAAGACGCTTACAGGAGACATGTCAGATTTCAACATTCAGAAACTTTCGAGAGAGTTActtgtgatttttgccaaaagtCTTTCAAGCAGCGAGGTGATCTTAACAGACATGTTAAAATAAACCACTCAACCAGTGAGGAAAGTTTCAAGTGTGACATTTGCGAAAAGACTTATAAGGATAAACGCTACTTGAAAGCCCATGTTAAAAGACAGCATCAATAA
Protein Sequence: MCEETQNILKDIKEEESLDIKEDTMDLADETQLEEILSHHEGFKCDFCDKSFKFNKILINHINTVHSIKESFNCEFCERTFKDKDYLEDHVKRLHQSAVELSHCEFCDKYFKDIDSFRRHVNCQHSEAFEKITCDFCLKSFKNQGNLKRHIKIHHSSSDESFNCEFCDKTFKAKDYLEKHVKRQHQRILKLLQCEFCDKSFKDKDAFRRHVRFQHSEASERVTCDFCQKSFKRKSNLDLHVRLRHSTSDENYTCEFCGKTFKAKDYLEKHVKRQHPPILELLQCEFCDKSFKYKDAYRRHVRFQHSETFERVTCDFCQKSFKQRGDLNRHVKINHSTSEESFKCDICEKTYKDKRYLKAHVKRQHQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01107803;
90% Identity: iTF_01107803;
80% Identity: iTF_01107803;