Oell013604.1
Basic Information
- Insect
- Ophion ellenae
- Gene Symbol
- -
- Assembly
- GCA_963210295.1
- Location
- OY723389.1:12333481-12338312[+]
Transcription Factor Domain
- TF Family
- THAP
- Domain
- THAP domain
- PFAM
- PF05485
- TF Group
- Zinc-Coordinating Group
- Description
- The THAP domain is a putative DNA-binding domain (DBD) and probably also binds a zinc ion. It features the conserved C2CH architecture (consensus sequence: Cys - 2-4 residues - Cys - 35-50 residues - Cys - 2 residues - His). Other universal features include the location of the domain at the N-termini of proteins, its size of about 90 residues, a C-terminal AVPTIF box and several other conserved residues. Orthologues of the human THAP domain have been identified in other vertebrates and probably worms and flies, but not in other eukaryotes or any prokaryotes [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.4e-07 7e-05 24.3 0.0 2 71 6 74 5 97 0.66
Sequence Information
- Coding Sequence
- ATGGCGAAAAACTATTCGTACCCAGGGTGTCAAACTGGGCGAGACGCCAGCAGAGCAAAGTGCAAGCGCTTAGGAGTACGACAGTTGTCCGTCAACAAGGTTCCAAAGAATATGGTACAACGATGGAGCAGAGCCATCGGGGAGTGTCTCTCCCACACTGATTTCGTGTGCGAGCTtcacttttccaatgactcgatAATAAAAGAAGACCGCATCAAAATGCCTGATGGTACGATCGACGTAATTCCTCATCTTCGTCATACCCTCATCGCTGATGCTATGCCCATCGCAGTCCATAACACGgAAAACGGTGGTCAACCGGAACAGAATGTTCCCTGCGACCAGTTAGCCGGACCTTCTCATGGATCCGTAGCTATTTGCAACGACGCTGTCGTACATCAAGTGCCTACGACCTGTAACGATTTTCTTACTCCGACGGAGATTACCCGAGCTTGTTACGGCCACGCGCGGAAGGCCGCCGCGATACCGGAGTCGGGTTGA
- Protein Sequence
- MAKNYSYPGCQTGRDASRAKCKRLGVRQLSVNKVPKNMVQRWSRAIGECLSHTDFVCELHFSNDSIIKEDRIKMPDGTIDVIPHLRHTLIADAMPIAVHNTENGGQPEQNVPCDQLAGPSHGSVAICNDAVVHQVPTTCNDFLTPTEITRACYGHARKAAAIPESG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01101408;
- 90% Identity
- iTF_01100680;
- 80% Identity
- -