Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 1.8e-05 0.0021 19.0 0.1 2 23 117 138 116 138 0.96

2 6 4.9e-06 0.00057 20.7 3.5 1 23 144 166 144 166 0.98

3 6 1.4e-06 0.00017 22.4 2.7 1 23 172 194 172 194 0.99

4 6 0.00054 0.062 14.3 0.3 1 20 200 219 200 222 0.93

5 6 4.1e-06 0.00047 21.0 0.7 2 23 229 250 228 250 0.97

6 6 7.4e-08 8.5e-06 26.5 0.5 1 23 256 279 256 279 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	1.8e-05	0.0021	19.0	0.1	2	23	117	138	116	138	0.96
2	6	4.9e-06	0.00057	20.7	3.5	1	23	144	166	144	166	0.98
3	6	1.4e-06	0.00017	22.4	2.7	1	23	172	194	172	194	0.99
4	6	0.00054	0.062	14.3	0.3	1	20	200	219	200	222	0.93
5	6	4.1e-06	0.00047	21.0	0.7	2	23	229	250	228	250	0.97
6	6	7.4e-08	8.5e-06	26.5	0.5	1	23	256	279	256	279	0.98

Coding Sequence: ATGACATCTATGTTTGAACAACAAATCAAAAGTGAGCCGATGGGATTCTACTCGATTGCTTCTAGTCGATCTGACGGTACGAACTCTATGGTGAATCTGTCGGACGCGCGAGAGGGTCTTACGCGGGAAGGTCGGATGCAGCAGTCGCAGCAACGAACGATGCAGGcgcatcagcagcagcagccccagcagcagcagcaacaacagcagaaTGTCCAGCAGAACgtccagcagcagcagcagcagcagcagcaagcgcaacagcagcagcagcagcaggttACGGCGCCGACGCGTCAGTCGACGGGTCAACAGACTGTAAAGGAAGGGACGCGCTCCAAGCCGCAGCCTTGCAAAGTTTGCGGTAAGGTTTTGTCGTCGGCCTCCTCGTACTACGTCCACATGAAGCTACACTCGGGCAACAAGCCCTATCATTGCACGGTGTGCGAGGCGAGCTTCTGTCGCAAGCCTTATCTCGAGGTACACATGAGAACGCACACGGGCGAGAGGCCCTTCCAGTGCGAGCTATGCCTGAAACGTTTTACCCAAAAGAGCAGCCTGAATACGCACAAACGCGTTCACACGGGCGAACGACCCTACGCCTGCGACATATGCCAAAAGCGTTTCGCCGTAAAGTCTTACGTAACGGCGCATCGCTGGAGCCACGTTGCCGAAAAACCGCTCGTATGCGACCGTTGCTCGCTAACGTTCACGTCGAAGAGCCAATTCGCAATACACATTCGTACACACACGGCGAGCACGACCTACGAGTGCAACATATGCGGTCGTACGTTCGTACGCGACAGCTATCTGATAAGACACCAGAATCGCGTACATCGCGACATGAGCAACAATCAGACCACCGGCAATCACAATCCACCGACGCCCCAGAGCACCGGGGGCGGCACCACTTCCGGCGGCTTCGAATCGCCCGTTTGCGATTTACGCTACAACGACGGGCCGTCCTCCCTCGAGTCGTTGGGCGGTAGCAAAGGCGGCATCGCCGCCGAAATAGCCAGTTTAGCGAAGCAAAACAATCTTCAGCTTCCACTACCGTTGCTACATCCGCAGACGACCAACTAG
Protein Sequence: MTSMFEQQIKSEPMGFYSIASSRSDGTNSMVNLSDAREGLTREGRMQQSQQRTMQAHQQQQPQQQQQQQQNVQQNVQQQQQQQQQAQQQQQQQVTAPTRQSTGQQTVKEGTRSKPQPCKVCGKVLSSASSYYVHMKLHSGNKPYHCTVCEASFCRKPYLEVHMRTHTGERPFQCELCLKRFTQKSSLNTHKRVHTGERPYACDICQKRFAVKSYVTAHRWSHVAEKPLVCDRCSLTFTSKSQFAIHIRTHTASTTYECNICGRTFVRDSYLIRHQNRVHRDMSNNQTTGNHNPPTPQSTGGGTTSGGFESPVCDLRYNDGPSSLESLGGSKGGIAAEIASLAKQNNLQLPLPLLHPQTTN

Sequence clustering based on sequence similarity using MMseqs2