Obrm015817.1
Basic Information
- Insect
- Operophtera brumata
- Gene Symbol
- -
- Assembly
- GCA_001266575.1
- Location
- JTDY01010285.1:2196-3725[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.0056 5 6.8 0.0 27 39 7 19 4 22 0.89 2 3 6.6e-11 5.9e-08 32.2 0.1 2 30 37 65 36 66 0.94 3 3 1.1e-06 0.001 18.7 0.3 11 30 68 87 67 88 0.91
Sequence Information
- Coding Sequence
- ATGTATTCTGATTTGGCAGGTATCCCCAGCAGCACGCTTTACAAGATAGCGCGTCGCGAGGGCATCCGCCTGGCGGCGCCCTTCAACGCGGCGCCCGTCGCGTGGCGCCGCGGGGACCTGCAGCGCGCGCTGGCCGCCATCCGCGCCGGCCGCGCCTCCGTGCAGCGAGCTGCCTCGCACTATGGAATACCTACTGGTAATTACATCCGCGCCGGCCGCGCCTCCGTGCATCAAGCTGCTTCGCACTATGGAATACCTACTGCTAATTACAAACTAGCAGATAACTTTGAAGATTCGCTGACGCTGATCCAACAGAATTGGTCTACAATA
- Protein Sequence
- MYSDLAGIPSSTLYKIARREGIRLAAPFNAAPVAWRRGDLQRALAAIRAGRASVQRAASHYGIPTGNYIRAGRASVHQAASHYGIPTANYKLADNFEDSLTLIQQNWSTI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -