Basic Information

Insect: Ontholestes murinus
Gene Symbol: ZBTB47
Assembly: GCA_963969525.1
Location: OZ018388.1:67386294-67387085[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0034 1.2 12.2 0.4 1 23 8 30 8 30 0.96

2 9 8.9e-05 0.031 17.2 1.1 1 23 38 61 38 61 0.97

3 9 0.00039 0.14 15.2 4.6 1 23 69 91 69 91 0.93

4 9 1.1e-05 0.0037 20.1 0.8 1 23 97 120 97 120 0.96

5 9 0.024 8.3 9.5 2.2 1 23 127 150 127 150 0.93

6 9 8.9e-06 0.0031 20.3 2.5 2 23 156 177 155 177 0.96

7 9 1.3e-06 0.00044 23.0 2.8 1 23 182 204 182 204 0.98

8 9 2.6e-06 0.00089 22.0 2.6 1 23 210 232 210 232 0.99

9 9 5.1e-06 0.0018 21.1 1.4 1 21 238 258 238 263 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0034	1.2	12.2	0.4	1	23	8	30	8	30	0.96
2	9	8.9e-05	0.031	17.2	1.1	1	23	38	61	38	61	0.97
3	9	0.00039	0.14	15.2	4.6	1	23	69	91	69	91	0.93
4	9	1.1e-05	0.0037	20.1	0.8	1	23	97	120	97	120	0.96
5	9	0.024	8.3	9.5	2.2	1	23	127	150	127	150	0.93
6	9	8.9e-06	0.0031	20.3	2.5	2	23	156	177	155	177	0.96
7	9	1.3e-06	0.00044	23.0	2.8	1	23	182	204	182	204	0.98
8	9	2.6e-06	0.00089	22.0	2.6	1	23	210	232	210	232	0.99
9	9	5.1e-06	0.0018	21.1	1.4	1	21	238	258	238	263	0.91

Sequence Information

Coding Sequence: ATGAAAGAACATCTAGGAACTTATAAATGCACGCGGTGTGATGAGGTAACAGATGACCAACTTTATCTAGAATCCCACTTTAATGGCCATAAAGCAGGCgatgctttaaattttaaatgtgcgCTGTGTTCGAAAgtgttaaagaataaaaaaagctTGTCGGGTCACATGCGACTAACTCATGGATTCAACGCTAAGAATAAGTATACTTGTAACCTATGTGATAAGGTGTTTTATACGAAATGTTACTTTATTAAACATTCTGATTTGCATAAGAATAAGAAACCCCATACGTGTAAAGAATGCGGTAAGGTTTTTATAAACACGAGGGATTTAGATGCTCATGCGAAATCCAGTCACGATCAGTCTTTGCAGTATTTTTACtgtgaaatatgtaaaaaagaTGTTTACCAAAAGAGAGGTTTTCGATACCACCTATATAATTCTCATAATGAAAAGAACTGTGTGTGCGACAGTTGTGGCGTGAAGTTTTCTAGCCCCTCTAAATTTAGAGAACATATGCGTAAACATACTGGTAATATGTACAAATGTAAAAGTTGTGAAAAATCCTTCACAAGGTCATATTCCTTGAAAGAGCATGAAAAGGTACATACGGGCGCAAAGCCTTATAAATGTGACGAATGTGGCACGTGCTTCTCTCGACTGGAAACCAGGACTGTACATATGAGGCTTCATACGGGAGAAAGGCCATATCTTTgtcatatttgtaataaatcatttatatctAGATCTGCACTGTACAAGCACCAGTCAAAAGCCGAGAATCATTAG
Protein Sequence: MKEHLGTYKCTRCDEVTDDQLYLESHFNGHKAGDALNFKCALCSKVLKNKKSLSGHMRLTHGFNAKNKYTCNLCDKVFYTKCYFIKHSDLHKNKKPHTCKECGKVFINTRDLDAHAKSSHDQSLQYFYCEICKKDVYQKRGFRYHLYNSHNEKNCVCDSCGVKFSSPSKFREHMRKHTGNMYKCKSCEKSFTRSYSLKEHEKVHTGAKPYKCDECGTCFSRLETRTVHMRLHTGERPYLCHICNKSFISRSALYKHQSKAENH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -