Basic Information

Transcription Factor Domain

TF Family: AP-2
Domain: TF_AP-2 domain
PFAM: PF03299
TF Group: Basic Domians group
Description: Activator protein-2 (AP-2) transcription factors constitute a family of closely related and evolutionarily conserved proteins that bind to the DNA consensus sequence GCCNNNGGC and stimulate target gene transcription [PMID: 2010091, PMID: 1998122]. Four different isoforms of AP-2 have been identified in mammals, termed AP-2 alpha, beta, gamma and delta. Each family member shares a common structure, possessing a proline/glutamine-rich domain in the N-terminal region, which is responsible for transcriptional activation [PMID: 2010091], and a helix-span-helix domain in the C-terminal region, which mediates dimerisation and site-specific DNA binding [PMID: 199812]. http://www.ebi.ac.uk/interpro/entry/IPR013854
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.00029 5.6 6.9 0.0 1 16 9 24 9 24 0.92

2 3 4.1e-14 7.8e-10 39.0 0.2 46 83 23 60 21 62 0.94

3 3 2e-17 3.7e-13 49.9 0.0 134 192 57 115 56 115 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.00029	5.6	6.9	0.0	1	16	9	24	9	24	0.92
2	3	4.1e-14	7.8e-10	39.0	0.2	46	83	23	60	21	62	0.94
3	3	2e-17	3.7e-13	49.9	0.0	134	192	57	115	56	115	0.95

Coding Sequence: ATGACAGCAAGTCCTTCGGATATCTTCTGTTCTGTCCCCGGACGACTGAGTCTCCTGAGCTCAACAGCAAAATCAAAAAATGGCGGTAGACTACTTCGAGAAAAGCTGGAAAACATAGGACTAAACTTACCAGCAGGTCGAAGGAAAGCTGCTAACGTCACGCTACTGACGCAGATCACCAAGGAACTGATAGAGCTTCTAAACCAGGATAGGTCACCACTCTGCAACACTCGTCCTCAGCAGATCTTGGAGCCTTCCATACAGAGAAGTCTCACACACTTCTCCCTCATCAGCCATGGCTTCGGCAGTCCTGCCATTGTCGCAGTGCTTACTGCAGTTCAGAATTAA
Protein Sequence: MTASPSDIFCSVPGRLSLLSSTAKSKNGGRLLREKLENIGLNLPAGRRKAANVTLLTQITKELIELLNQDRSPLCNTRPQQILEPSIQRSLTHFSLISHGFGSPAIVAVLTAVQN

Sequence clustering based on sequence similarity using MMseqs2