Oorn122249.1
Basic Information
- Insect
- Odontomyia ornata
- Gene Symbol
- CREB3L3
- Assembly
- GCA_963969285.1
- Location
- OZ017741.1:253670133-253670914[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.7 9.2e+03 -0.1 0.0 30 49 31 50 28 60 0.63 2 2 1e-13 5.4e-10 42.3 7.2 2 63 75 134 74 135 0.94
Sequence Information
- Coding Sequence
- ATGTCAGTGAATTTAGGTCACgATCATACGTCAGGTGTCGACAGTTTCATTCTGGAAGACAATCAAGATGAAGGATACGACTGTGATGATTTGGAAGCGAAATGCAGTGATTCGGAGGCGTCGTATCCAAAACTAGTTTTAACAGCACAAGAAAAACGTCTGCTGGCTAAAGAAGGAATCACATTACCTACACATTATCTGCTTAAAAAACATGAAAAGCGTGAATTGAAGCGCATTCGACGCAAAATCCGAAATAAGATTTCCGTGCAGGATTCGCGGAAAAAGGAATATGTTGATGGATTAGAGGAGAGAGTTCGGCAATGCACAGACGATAATCAACTATTGTTGAAACGAATAAAAATCCTACTGACACAAAATCAAAACTTGGTGTCACAAATGAAAAAGTAG
- Protein Sequence
- MSVNLGHDHTSGVDSFILEDNQDEGYDCDDLEAKCSDSEASYPKLVLTAQEKRLLAKEGITLPTHYLLKKHEKRELKRIRRKIRNKISVQDSRKKEYVDGLEERVRQCTDDNQLLLKRIKILLTQNQNLVSQMKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01087662;
- 90% Identity
- -
- 80% Identity
- -