Basic Information

Transcription Factor Domain

TF Family: HTH
Domain: HTH_psq domain
PFAM: PF05225
TF Group: Helix-turn-helix
Description: This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.49 4.9e+02 1.6 0.0 19 29 16 26 15 28 0.88

2 7 0.14 1.4e+02 3.3 0.0 17 29 32 44 30 46 0.90

3 7 0.49 4.9e+02 1.6 0.0 19 29 52 62 51 64 0.88

4 7 0.49 4.9e+02 1.6 0.0 19 29 70 80 69 82 0.88

5 7 0.14 1.4e+02 3.3 0.0 17 29 86 98 84 100 0.90

6 7 0.49 4.9e+02 1.6 0.0 19 29 106 116 105 118 0.88

7 7 0.38 3.8e+02 1.9 0.0 19 29 124 134 123 146 0.86

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.49	4.9e+02	1.6	19	29	16	26	15	28	0.88
2	7	0.14	1.4e+02	3.3	17	29	32	44	30	46	0.90
3	7	0.49	4.9e+02	1.6	19	29	52	62	51	64	0.88
4	7	0.49	4.9e+02	1.6	19	29	70	80	69	82	0.88
5	7	0.14	1.4e+02	3.3	17	29	86	98	84	100	0.90
6	7	0.49	4.9e+02	1.6	19	29	106	116	105	118	0.88
7	7	0.38	3.8e+02	1.9	19	29	124	134	123	146	0.86

Coding Sequence: ATGGCTGACTATTATGAAATATCACAAGATATAgatacccagaccatctgcaaGATGGCTGACTATTATGAAATATCACAAGATATAGATACCCTGACCATCTGCAAGATGGCTGACTATTATGAAATATCACAAGATATAgatacccagaccatctgcaaGATGGCTGACTATTATGAAATATCACAAGATATAgatacccagaccatctgcaaGATGGCTGACTATTATGAAATATCACAAGATATAGATACCCTGACCATCTGCAAGATGGCTGACTATTATGAAATATCACAAGATATAgatacccagaccatctgcaaGATGGCTGACTATTATGAAATATCACAAGATATAgatacccagaccatctgcaaGATGGCTGACTATTATGAAATATCACAAGATATAGATAGCCAAACCCTTTCGAAGTATCTCATCATCCAACCTTACTCCTTATATAGATCATga
Protein Sequence: MADYYEISQDIDTQTICKMADYYEISQDIDTLTICKMADYYEISQDIDTQTICKMADYYEISQDIDTQTICKMADYYEISQDIDTLTICKMADYYEISQDIDTQTICKMADYYEISQDIDTQTICKMADYYEISQDIDSQTLSKYLIIQPYSLYRS

Sequence clustering based on sequence similarity using MMseqs2