Basic Information

Insect: Odontocerum albicorne
Gene Symbol: -
Assembly: GCA_949825065.1
Location: OX463852.1:43629599-43630186[-]

Transcription Factor Domain

TF Family: Nrf1
Domain: Nrf1_DNA-bind domain
PFAM: PF10491
TF Group: Basic Domians group
Description: In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human [1]. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila [2]. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Swiss-Prot:Q8C4C0 there is also an NLS domain at 88-116, and a DNA binding and dimerisation domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.093 1.1e+03 0.1 0.0 61 81 4 24 2 28 0.75

2 11 0.012 1.4e+02 3.0 0.0 58 81 15 38 9 43 0.78

3 11 0.039 4.8e+02 1.3 0.0 66 81 37 52 27 58 0.64

4 11 0.041 5e+02 1.2 0.0 66 81 51 66 41 71 0.63

5 11 0.027 3.3e+02 1.8 0.0 62 81 61 80 49 86 0.61

6 11 0.031 3.8e+02 1.6 0.0 63 81 76 94 66 100 0.62

7 11 0.036 4.4e+02 1.4 0.0 63 81 90 108 81 112 0.60

8 11 0.036 4.4e+02 1.4 0.0 65 81 106 122 96 128 0.63

9 11 0.036 4.4e+02 1.4 0.0 63 81 132 150 123 154 0.60

10 11 0.032 3.9e+02 1.6 0.0 63 81 146 164 136 169 0.61

11 11 0.037 4.5e+02 1.4 0.0 63 82 174 193 165 195 0.58

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.093	1.1e+03	0.1	61	81	4	24	2	28	0.75
2	11	0.012	1.4e+02	3.0	58	81	15	38	9	43	0.78
3	11	0.039	4.8e+02	1.3	66	81	37	52	27	58	0.64
4	11	0.041	5e+02	1.2	66	81	51	66	41	71	0.63
5	11	0.027	3.3e+02	1.8	62	81	61	80	49	86	0.61
6	11	0.031	3.8e+02	1.6	63	81	76	94	66	100	0.62
7	11	0.036	4.4e+02	1.4	63	81	90	108	81	112	0.60
8	11	0.036	4.4e+02	1.4	65	81	106	122	96	128	0.63
9	11	0.036	4.4e+02	1.4	63	81	132	150	123	154	0.60
10	11	0.032	3.9e+02	1.6	63	81	146	164	136	169	0.61
11	11	0.037	4.5e+02	1.4	63	82	174	193	165	195	0.58

Sequence Information

Coding Sequence: ATGTTCGGTTGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTTGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCGCGGATGTTCGGTAGTACCCCCTTAGACAAAGTCAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACAAAGTTAATAGTGCCCGGATGTTCGGTAGTACCCCCTTAGACACGTGTTTAAAAGCCTAG
Protein Sequence: MFGCTPLDKVNSARMFGCTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDKVNSARMFGSTPLDTCLKA

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -