Basic Information

Transcription Factor Domain

TF Family: GTF2I
Domain: GTF2I domain
PFAM: PF02946
TF Group: Other Alpha-Helix Group
Description: This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00037 16 7.2 0.0 26 52 5 32 1 43 0.72

2 4 0.0039 1.8e+02 3.8 0.0 33 51 49 67 43 71 0.83

3 4 0.0007 31 6.3 0.0 25 51 76 103 72 106 0.75

4 4 0.012 5.5e+02 2.3 0.0 37 51 107 121 99 123 0.83

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00037	16	7.2	26	52	5	32	1	43	0.72
2	4	0.0039	1.8e+02	3.8	33	51	49	67	43	71	0.83
3	4	0.0007	31	6.3	25	51	76	103	72	106	0.75
4	4	0.012	5.5e+02	2.3	37	51	107	121	99	123	0.83

Coding Sequence: atggatgggttaccatacggagccaggttaagcaaccctcaccaaggtttggaaatagatgggttaccacagggggccaggttaagcaacccttgccaaggtttgggaatggataggttaacacaaggagccaggttaagcaaccctcaccaaggtttggaaatggatgggttaccacacggggccaggttaagcaacccttgccgaggtttgaaaatggatgggttaccatacggagccaggttaagcaaccctcaccaaggtttggaaatggatgggttaccacagggggccaggttaagcaacccttgccaaggtttgggaatggatgggttaccacagggggccaggttaagcaacccttgccgaggtttggaaatggatgggtaa
Protein Sequence: MDGLPYGARLSNPHQGLEIDGLPQGARLSNPCQGLGMDRLTQGARLSNPHQGLEMDGLPHGARLSNPCRGLKMDGLPYGARLSNPHQGLEMDGLPQGARLSNPCQGLGMDGLPQGARLSNPCRGLEMDG*

Sequence clustering based on sequence similarity using MMseqs2