Nnit000193.1
Basic Information
- Insect
- Nymphula nitidulata
- Gene Symbol
- CAMTA1
- Assembly
- GCA_947347705.1
- Location
- OX374627.1:3368902-3371781[+]
Transcription Factor Domain
- TF Family
- CG-1
- Domain
- CG-1 domain
- PFAM
- PF03859
- TF Group
- Unclassified Structure
- Description
- CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [2]. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.6e-19 5.4e-15 56.0 0.0 40 90 2 50 1 70 0.79
Sequence Information
- Coding Sequence
- ATGCTGCTGTACAGCCGAAAGAAGGTCAGATACCGACGCGACGGCTACTGCTGGAAGAAGAGAAAAGACGGGAAGACCACCAGGGAGGACCATATGAAGCTCAAGGTCCAGGGGACTGAGATGTCGTGCAAGAATAATTCACGTAACAGCAGTCCAGCCTGTTTGCTATCATTTTCAAGATACTGTTGGTGCCCCCCCCCCCCCCCCCCCCCGCACTCTGCTCACCAGGGAAGCACACCTCTTCCGCATAGTCACATAGAAGCAGTCGACCAAAGGCAGGCACTTGACCACAATCTCACGTGGTTGTGGTGCCGGTGA
- Protein Sequence
- MLLYSRKKVRYRRDGYCWKKRKDGKTTREDHMKLKVQGTEMSCKNNSRNSSPACLLSFSRYCWCPPPPPPPHSAHQGSTPLPHSHIEAVDQRQALDHNLTWLWCR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -