Nscu021390.1
Basic Information
- Insect
- Nephrocerus scutellatus
- Gene Symbol
- Runx1
- Assembly
- GCA_947095585.1
- Location
- OX352763.1:27644549-27645183[-]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.95 5.5e+03 -1.9 2.9 51 77 7 33 2 76 0.61 2 2 1.1e-52 6.5e-49 166.0 0.0 3 101 86 184 84 190 0.95
Sequence Information
- Coding Sequence
- ATGCATTTAACGGCAACCACAACAGTTAATACGAACTCGAACAACAACAACAACTCCACCACAACCAACAACAACAACAACACAAACACCAATAACAACAACAGTAGCAGCAACAACAGCAACAATGGCTCAACAAATAATGGCTCCAGCGGTACAACAACGGAACAGCAGAGTACACCGCCGACGGCAGCACAGCTCCTCAACGAGGCCTACACAAAAATGACATCGGACATTTTGGCGGAACGAACGCTCGGCGATTTCCTCACAGAGCATCCGGGTGAATTGATTCGGACCGGAAGTCCACTGCTAGTGTGCACAGTGCTgccgccacactggcgttcgaacaagacacttccggtggcattcaaagttgtatcgctgggcgacatcggcgacggcaccttggtcactgtgcgcgccggcaacgacgagaactactgcgccgagctacgcaactgcacggcagtaatgaagaatcaagtggccaaatttaatgacttgcgattcgtcggccgcagtggacgagGACAAGGGTGCCGGCTGACAAGTGCTCTTCTTGGCCAAACGGCAATGTAA
- Protein Sequence
- MHLTATTTVNTNSNNNNNSTTTNNNNNTNTNNNNSSSNNSNNGSTNNGSSGTTTEQQSTPPTAAQLLNEAYTKMTSDILAERTLGDFLTEHPGELIRTGSPLLVCTVLPPHWRSNKTLPVAFKVVSLGDIGDGTLVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGQGCRLTSALLGQTAM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00310784;
- 90% Identity
- -
- 80% Identity
- -