Nswa033958.1
Basic Information
- Insect
- Nematopogon swammerdamellus
- Gene Symbol
- -
- Assembly
- GCA_946902865.1
- Location
- CAMPPV010002269.1:25920-27104[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 10 1.3e-05 0.001 20.3 0.3 2 23 105 126 104 126 0.96 2 10 0.053 4 9.0 0.6 1 23 130 153 130 153 0.94 3 10 0.0072 0.55 11.7 0.3 1 23 158 181 158 181 0.94 4 10 0.00013 0.0098 17.2 0.6 2 23 185 206 184 206 0.97 5 10 0.001 0.078 14.3 0.3 2 20 211 229 210 231 0.91 6 10 2e-06 0.00015 22.9 1.7 1 23 241 264 241 264 0.97 7 10 0.071 5.4 8.6 0.9 2 23 270 291 269 291 0.95 8 10 0.0018 0.14 13.6 1.6 1 23 297 320 297 320 0.96 9 10 0.018 1.4 10.4 0.4 1 23 326 349 326 349 0.96 10 10 5.6e-06 0.00042 21.5 1.8 3 23 356 376 355 376 0.98
Sequence Information
- Coding Sequence
- ATGCTTCCGGAAACCCTTTGTATTTCCTGCACTAACTCCGCCGTCGCTAGCTACTCGTTCCTCCAGCTGTGTCGCGCCTCAGCGACGAGCGTGCACTCCACGCTCGCCGCGCTGCAGCGGTGCGAGCGTGTACCCCCCACACGCGGCCCCGCTGTCAAGACTCTATACCTCGTACTGGAGGACGAGCGCACCAAGGTGATAGCTGACCGGTCAACGCGACCCCGCGGCAAGCCGCAGGCACTGGCTCGCGTGCTTTCTCTTATAGCGGCGGGTGCGCCGTGCGCCGCTGGCCAACGCTCGCCCGCACAGCTGCAGTGCGAAGACTGCGGCAACATTTTCAGCACGGAGCACGCGCTGCGGCGTCACCTCGCCGTGCACGCGGAGCCCCACATGTGCTCACTGTGCACCAACACGTACGCCACGCGCGCCAAGCTCGCACTGCACACGGCGCGCGCGCACAACGACAAGACGCACCGGTGCGCCGAGTGTCCCAAGCGCTTCGGCTCGGCGTACCTGGCGGAGGAGCACCGCAAGGCGATGCACACGCACGTCGAGTGCGGCGTGTGCGGCCGCGGCTTCACCAACAAGCACGCGCGCCGCGCACACCAGCTCTCGCACGGGGAGCGCTGGCCGTGCGCGCGCTGCCGCAAGACTTTCAAGTACAAGGAGGGCCTCAAGCGACACGCCCTGAGGTGCGTCCAAGGAGTTCCGTGCGAGCGATTCACCTGCGACGACTGCGGCAAGACATACTCCAGCAAGGGCACGCTGGTGCAGCACGTGCGCCACCAGCACGGCGACAACCCGCTCTCGTGCGAGCTCTGCGGACAGAGCTTCCTCGACGCCGGCAAGCTGCGGTGCCACATGTCCTCGCACACGGGAGTGAAGCGGTTCGAGTGCGAGCTGTGCCGCGCGCGCTTCTCCTACTCCACTACGCTTACCTACCACACGCGCGCCTTCCACACGGGCGAGCGGCCCTTCCCCTGCGACGAGTGCGCGCAGAGCTTCATCACGTCCTCGGTGCGGCTCGTGCACAAGCGGCGCTACCACGGCGCGCCCGCGCCGCACTGCCCCGTGTGCGGCGCGCGCTTCGTCACGCGCGGCCGCCTGCGCAGACACATGAGGAAGCACGCAACTGCACGTCTCATGTCCACGCCTCTCTTCAACGAATGCGTTCTCAGCACATAA
- Protein Sequence
- MLPETLCISCTNSAVASYSFLQLCRASATSVHSTLAALQRCERVPPTRGPAVKTLYLVLEDERTKVIADRSTRPRGKPQALARVLSLIAAGAPCAAGQRSPAQLQCEDCGNIFSTEHALRRHLAVHAEPHMCSLCTNTYATRAKLALHTARAHNDKTHRCAECPKRFGSAYLAEEHRKAMHTHVECGVCGRGFTNKHARRAHQLSHGERWPCARCRKTFKYKEGLKRHALRCVQGVPCERFTCDDCGKTYSSKGTLVQHVRHQHGDNPLSCELCGQSFLDAGKLRCHMSSHTGVKRFECELCRARFSYSTTLTYHTRAFHTGERPFPCDECAQSFITSSVRLVHKRRYHGAPAPHCPVCGARFVTRGRLRRHMRKHATARLMSTPLFNECVLST
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01042921;
- 90% Identity
- iTF_01042921;
- 80% Identity
- -