Basic Information

Insect: Nebria ingens
Gene Symbol: -
Assembly: GCA_018344505.1
Location: JADQWA010000577.1:158370-159511[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0083 0.68 10.5 0.3 1 20 146 165 146 168 0.94

2 7 2.5e-05 0.002 18.5 0.3 3 23 176 196 174 196 0.96

3 7 9e-07 7.3e-05 23.0 0.4 1 23 202 224 202 224 0.98

4 7 4.7e-05 0.0038 17.6 0.3 3 23 232 252 230 252 0.96

5 7 1.6e-06 0.00013 22.2 0.3 2 23 259 280 258 280 0.97

6 7 3e-06 0.00024 21.4 1.1 1 23 286 308 286 308 0.99

7 7 1.8e-06 0.00014 22.1 1.4 1 23 314 336 314 336 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0083	0.68	10.5	0.3	1	20	146	165	146	168	0.94
2	7	2.5e-05	0.002	18.5	0.3	3	23	176	196	174	196	0.96
3	7	9e-07	7.3e-05	23.0	0.4	1	23	202	224	202	224	0.98
4	7	4.7e-05	0.0038	17.6	0.3	3	23	232	252	230	252	0.96
5	7	1.6e-06	0.00013	22.2	0.3	2	23	259	280	258	280	0.97
6	7	3e-06	0.00024	21.4	1.1	1	23	286	308	286	308	0.99
7	7	1.8e-06	0.00014	22.1	1.4	1	23	314	336	314	336	0.96

Sequence Information

Coding Sequence: ATGGAAGAAACAATCATATTGGATTTAGATAAAATTTGTCGAGCTTGCTTGCTTGAAAAGCCTGAAATGCAATCGTTAGTTGATGAACAAATCGCTGAAATGTTCACTTCTTGTACTTCTATTTCGGTATCTTCAAATGACGGTCTACCTATTTTGTTGTGTTGCGATTGTATACAACTAATAAATCAATCGTATTTGTTTAAACAACAAAGTTTAAAATCAGATGAAATATTGCACCAATACCAATCAAATTTAAAAAATCAAGAAATCGAATTTAGTATATCTGAATATTTAAAAACTGATATCAAATTAGAGAAAATTGAAGAATGCTCAACAAATGAGACCCAATCTGAATCATTTGATGAATCAGATGTTAAAACAAAAAAACCTATAAAAACAAAGAAGAAAATTAGAAATAACACCTCTAACAACACGTTTATATGTAATATTTGTAGCGAAGGCTTTGAGTTAAATGACGATTTAGATATACACATGATTTGCCATCCGAAAGATGGTAAAATCATTTGTACAATATGCCAAAAAGAATTCACTAATATAAAAGTTTTAAGACGTCATGTTAGGATTCATATGACTAATAAACCGTTCAACTGTGAGGTTTGCAATAAAGGCTTTGCAGAATCTGGTAGTTTAACGCGACATTTGCGCAAGCATAAAGGTGAAAAAAGGCATTTGTGTACCGTGTGTGGGAAAGGATTTTATGAAGCGAATGTACTCGCTGTTCATATGAGGACTCATACAGGCGAAAAACCGATTGAATGTAGTGAATGCACGAAACGTTTTGCTGATCCTAACGGATTGAGATCTCACATGAAATCGCATACTGGCGAGAAAAAATATGTTTGCGAGATTTGTAATAAACCATTTGGGCATTCGTTTGTTTTAAAAAAACACTTGAGAGTGCATAGCGGAGAGCGACCGTATTTATGTGCTGTTTGTGGCAAATCTTTCACACAATCACATTATGTTAATATACATATGAGACAACATACAGGTAAAGATAGCTAA
Protein Sequence: MEETIILDLDKICRACLLEKPEMQSLVDEQIAEMFTSCTSISVSSNDGLPILLCCDCIQLINQSYLFKQQSLKSDEILHQYQSNLKNQEIEFSISEYLKTDIKLEKIEECSTNETQSESFDESDVKTKKPIKTKKKIRNNTSNNTFICNICSEGFELNDDLDIHMICHPKDGKIICTICQKEFTNIKVLRRHVRIHMTNKPFNCEVCNKGFAESGSLTRHLRKHKGEKRHLCTVCGKGFYEANVLAVHMRTHTGEKPIECSECTKRFADPNGLRSHMKSHTGEKKYVCEICNKPFGHSFVLKKHLRVHSGERPYLCAVCGKSFTQSHYVNIHMRQHTGKDS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -