Basic Information

Transcription Factor Domain

TF Family: AP-2
Domain: TF_AP-2 domain
PFAM: PF03299
TF Group: Basic Domians group
Description: Activator protein-2 (AP-2) transcription factors constitute a family of closely related and evolutionarily conserved proteins that bind to the DNA consensus sequence GCCNNNGGC and stimulate target gene transcription [PMID: 2010091, PMID: 1998122]. Four different isoforms of AP-2 have been identified in mammals, termed AP-2 alpha, beta, gamma and delta. Each family member shares a common structure, possessing a proline/glutamine-rich domain in the N-terminal region, which is responsible for transcriptional activation [PMID: 2010091], and a helix-span-helix domain in the C-terminal region, which mediates dimerisation and site-specific DNA binding [PMID: 199812]. http://www.ebi.ac.uk/interpro/entry/IPR013854
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0021 41 5.0 0.0 158 177 52 71 44 81 0.86

2 4 0.002 38 5.1 0.0 158 177 87 106 74 114 0.86

3 4 0.0018 35 5.2 0.0 158 178 122 142 111 155 0.86

4 4 0.0021 40 5.1 0.0 158 177 157 176 146 185 0.86

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0021	41	5.0	158	177	52	71	44	81	0.86
2	4	0.002	38	5.1	158	177	87	106	74	114	0.86
3	4	0.0018	35	5.2	158	178	122	142	111	155	0.86
4	4	0.0021	40	5.1	158	177	157	176	146	185	0.86

Coding Sequence: atgggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaactcatgggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaactcatggggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaactcatggggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaactcatggggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaactcatgggggctcatcggcgcctgcttcgagccctacctgtcgctctacgtcagctcgctcgacaccaacctcgccgagctcatggaccgcttcgtgcaggtaa
Protein Sequence: MGAHRRLLRALPVALRQLARHQPRRAHGPLRAGNSWGLIGACFEPYLSLYVSSLDTNLAELMDRFVQVTHGGLIGACFEPYLSLYVSSLDTNLAELMDRFVQVTHGGLIGACFEPYLSLYVSSLDTNLAELMDRFVQVTHGGLIGACFEPYLSLYVSSLDTNLAELMDRFVQVTHGGSSAPASSPTCRSTSARSTPTSPSSWTASCR

Sequence clustering based on sequence similarity using MMseqs2