Mmin011188.1
Basic Information
- Insect
- Molorchus minor
- Gene Symbol
- nfx-1_1
- Assembly
- GCA_029963825.1
- Location
- JAPWTJ010000439.1:382-858[+]
Transcription Factor Domain
- TF Family
- zf-NF-X1
- Domain
- zf-NF-X1 domain
- PFAM
- PF01422
- TF Group
- Zinc-Coordinating Group
- Description
- This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 1.9e-06 0.02 15.7 4.9 9 19 5 15 3 15 0.91 2 5 1.4 1.5e+04 -3.0 0.2 18 18 22 22 20 23 0.49 3 5 0.42 4.4e+03 -1.4 0.8 6 10 41 45 41 45 0.93 4 5 1.1e-10 1.2e-06 29.2 13.5 1 18 51 68 51 69 0.98 5 5 3 3.2e+04 -4.6 1.1 18 18 98 98 96 99 0.53
Sequence Information
- Coding Sequence
- ATGCACTCATTCCTATGCCATCCGGGTCCATGCCCTGATTGCAGTGTGATGGTGGAAAAGCCATGTGGCTGTGGGTCGACGAAGCAAATAGTAAAATGTAGCACAGATATAGAAATAATATGCACTTCAGTTTGTAATAAAATTCTGAACTGCGGTATTCATCAATGTAAATCTAAATGTCATGATGGGCCTTGTGATCCTTGTGCTAGAGATGTTAGTGTGGTACACTCGTGTCCTTGTGGGAAGACCCCTTTGGAGAAAGCAAGGGCATCTTGTCGTGATCCTATTCCGTGTTGTGACTAA
- Protein Sequence
- MHSFLCHPGPCPDCSVMVEKPCGCGSTKQIVKCSTDIEIICTSVCNKILNCGIHQCKSKCHDGPCDPCARDVSVVHSCPCGKTPLEKARASCRDPIPCCD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -