Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1.9e-06 0.02 15.7 4.9 9 19 5 15 3 15 0.91

2 5 1.4 1.5e+04 -3.0 0.2 18 18 22 22 20 23 0.49

3 5 0.42 4.4e+03 -1.4 0.8 6 10 41 45 41 45 0.93

4 5 1.1e-10 1.2e-06 29.2 13.5 1 18 51 68 51 69 0.98

5 5 3 3.2e+04 -4.6 1.1 18 18 98 98 96 99 0.53

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1.9e-06	0.02	15.7	4.9	9	19	5	15	3	15	0.91
2	5	1.4	1.5e+04	-3.0	0.2	18	18	22	22	20	23	0.49
3	5	0.42	4.4e+03	-1.4	0.8	6	10	41	45	41	45	0.93
4	5	1.1e-10	1.2e-06	29.2	13.5	1	18	51	68	51	69	0.98
5	5	3	3.2e+04	-4.6	1.1	18	18	98	98	96	99	0.53

Coding Sequence: ATGCACTCATTCCTATGCCATCCGGGTCCATGCCCTGATTGCAGTGTGATGGTGGAAAAGCCATGTGGCTGTGGGTCGACGAAGCAAATAGTAAAATGTAGCACAGATATAGAAATAATATGCACTTCAGTTTGTAATAAAATTCTGAACTGCGGTATTCATCAATGTAAATCTAAATGTCATGATGGGCCTTGTGATCCTTGTGCTAGAGATGTTAGTGTGGTACACTCGTGTCCTTGTGGGAAGACCCCTTTGGAGAAAGCAAGGGCATCTTGTCGTGATCCTATTCCGTGTTGTGACTAA
Protein Sequence: MHSFLCHPGPCPDCSVMVEKPCGCGSTKQIVKCSTDIEIICTSVCNKILNCGIHQCKSKCHDGPCDPCARDVSVVHSCPCGKTPLEKARASCRDPIPCCD

Sequence clustering based on sequence similarity using MMseqs2