Basic Information

Insect: Micropterix aruncella
Gene Symbol: -
Assembly: GCA_944547385.1
Location: CALYMV010000075.1:47365-48138[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 4.6e-07 2.8e-05 25.5 0.7 1 23 29 52 29 53 0.95

2 8 0.00012 0.0071 17.9 0.0 1 23 58 81 58 81 0.92

3 8 3.4e-07 2.1e-05 25.9 0.4 1 23 87 110 87 110 0.94

4 8 8.9e-07 5.4e-05 24.6 0.8 1 23 116 139 116 140 0.96

5 8 1.3e-05 0.00081 20.9 0.3 1 23 145 168 145 168 0.94

6 8 4e-06 0.00024 22.5 2.0 1 23 174 197 174 197 0.97

7 8 2.1e-06 0.00013 23.4 0.1 2 23 204 226 203 226 0.94

8 8 5.2e-06 0.00032 22.1 0.3 1 23 232 255 232 255 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	4.6e-07	2.8e-05	25.5	0.7	1	23	29	52	29	53	0.95
2	8	0.00012	0.0071	17.9	0.0	1	23	58	81	58	81	0.92
3	8	3.4e-07	2.1e-05	25.9	0.4	1	23	87	110	87	110	0.94
4	8	8.9e-07	5.4e-05	24.6	0.8	1	23	116	139	116	140	0.96
5	8	1.3e-05	0.00081	20.9	0.3	1	23	145	168	145	168	0.94
6	8	4e-06	0.00024	22.5	2.0	1	23	174	197	174	197	0.97
7	8	2.1e-06	0.00013	23.4	0.1	2	23	204	226	203	226	0.94
8	8	5.2e-06	0.00032	22.1	0.3	1	23	232	255	232	255	0.95

Sequence Information

Coding Sequence: ATGATTAATACCATCGAAGACGAATCAGATATACCGGGTATCTCAGTAAACGCGAGTACTATTTTCAGCTGGCGGATACAGCAGTTTATATGCAGTGAATGCGGTAAGGTTTTCCCAAAAAAGGATACATTGGCGAGGCATATCAAGAATGTGCATCACAAGATTAAGAAATTCGCCTGTGATGAGTGCAGCAGCGCGTTCACGTCAAACGCTAACCTTATAAGACACATCGACGCGGTTCATCGCAGAGTTAAAGAGTTCGCGTGCAAGGATTGCGGCAAGGCTTTCACGGAAAAGGCGAATTTGAAAAAGCACACGAACGGCGTGCATGAAAAACTGAAAACTTACGCGTGTGAGATCTGCGAGCGCGCGTTCACCGAGAAGGGCAACCTAAAGAAGCATCTAAACACGGTTCACCACGGCGTCAAAAATCACGTGTGTGGTGAATGCGGTCGCGGGTTTACCCAGCAGGTCAGTCTGAAGACGCACGTCGACTCTGTCCATCTCAAACTGAAGAAGTTTAAGTGCAACGAGTGCGAGCGATGCTTCGCCGAACAGGGCAGCCTGAAGAAACACTTGCAATCCATACATTACAAAGTTAAAAACGTCGAATGCGAGGACTGTGGACGTGCCTTTACCAGGCGAGGCGATTTGACCACCCATTACAACGCCGTGCATAGGAAACTGAGGAAATATGCTTGTGGGCACTGTGACAAAGCATTTGCGAAGAGCAGCGGGTTAATCAGACACACAAAAGCAGTGCATTCTTCATAG
Protein Sequence: MINTIEDESDIPGISVNASTIFSWRIQQFICSECGKVFPKKDTLARHIKNVHHKIKKFACDECSSAFTSNANLIRHIDAVHRRVKEFACKDCGKAFTEKANLKKHTNGVHEKLKTYACEICERAFTEKGNLKKHLNTVHHGVKNHVCGECGRGFTQQVSLKTHVDSVHLKLKKFKCNECERCFAEQGSLKKHLQSIHYKVKNVECEDCGRAFTRRGDLTTHYNAVHRKLRKYACGHCDKAFAKSSGLIRHTKAVHSS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -