Basic Information

Transcription Factor Domain

TF Family: TEA
Domain: TEA domain
PFAM: PF01285
TF Group: Helix-turn-helix
Description: The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.016 3.3e+02 2.8 0.0 30 52 12 34 2 37 0.81

2 6 0.012 2.6e+02 3.2 0.0 30 52 40 62 34 67 0.84

3 6 0.017 3.5e+02 2.7 0.0 32 52 70 90 61 94 0.84

4 6 0.021 4.3e+02 2.4 0.0 30 52 96 118 89 122 0.83

5 6 0.0028 57 5.3 0.1 30 52 124 146 106 150 0.78

6 6 0.0019 39 5.8 0.1 24 51 174 201 145 212 0.61

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.016	3.3e+02	2.8	0.0	30	52	12	34	2	37	0.81
2	6	0.012	2.6e+02	3.2	0.0	30	52	40	62	34	67	0.84
3	6	0.017	3.5e+02	2.7	0.0	32	52	70	90	61	94	0.84
4	6	0.021	4.3e+02	2.4	0.0	30	52	96	118	89	122	0.83
5	6	0.0028	57	5.3	0.1	30	52	124	146	106	150	0.78
6	6	0.0019	39	5.8	0.1	24	51	174	201	145	212	0.61

Coding Sequence: ACTCACACGGGGGAGACGCCGCACAAGTGCGCGTACTGCGCAAAGGCGTTCAGCCGCAAAGAGCACTTGGTGAACCACGTGCGCCACCACACGGGGGAGACGCCGCACAAGTGCCACTTCTGCGCCAAGGCCTTCTCGCGCAAAGAGCACCTCAATAACCACATCAGGGTCCACACGGGGGAAACGCCACACAAGTGCACGTTCTGCCCGAAGGCGTTCAGCCGCAAGGAGCACCTCACCAACCACGTGAACCAGCACACGGGCCAGACGCCCCACAAATGCCACTTTTGCTCTAAGGGATTCTCCAGGAAAGAGCATCTCACCAATCATATCAGAATGCATACGGGTGAGACACCGCATAAATGCACGTACTGTCCAAAGGCGTTCAGCCGCAAAGAACACCTTACAAACCATATCCGGCAGCATACTGGCGAAACACCTCACAAGTGCCATTTTTGCTCAAAGTCATTCTCCAGGAAGGAGCACCTCGTCAACCACATCAGAATGCATACGGGGGAGTCCCCGCACCGCTGCGAGTTCTGCCAGAAGACGTTCACGCGCAAGGAGCACCTCACCAACCACCTGAAGCAGCACACGGGCGACACCCCCCACTCCTGCAAGATCTGCAGCAAGCCCTTCACGCGCAAGGAGCATCTCGTCAACCACATGAGGCAAGTCCTTTTTTCATTTCCCGCACGCGTCTACTTCTCTTAA
Protein Sequence: THTGETPHKCAYCAKAFSRKEHLVNHVRHHTGETPHKCHFCAKAFSRKEHLNNHIRVHTGETPHKCTFCPKAFSRKEHLTNHVNQHTGQTPHKCHFCSKGFSRKEHLTNHIRMHTGETPHKCTYCPKAFSRKEHLTNHIRQHTGETPHKCHFCSKSFSRKEHLVNHIRMHTGESPHRCEFCQKTFTRKEHLTNHLKQHTGDTPHSCKICSKPFTRKEHLVNHMRQVLFSFPARVYFS

Sequence clustering based on sequence similarity using MMseqs2