Maet011021.1
Basic Information
- Insect
- Microctonus aethiopoides
- Gene Symbol
- kn
- Assembly
- GCA_030347275.1
- Location
- JAQQBS010001423.1:2664558-2679721[+]
Transcription Factor Domain
- TF Family
- COE
- Domain
- COE domain
- PFAM
- AnimalTFDB
- TF Group
- Helix-turn-helix
- Description
- This is the helix-loop-helix domain of transcription factor COE. It is responsible for dimerisation [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-42 3.7e-38 131.1 0.0 39 116 20 97 12 102 0.95
Sequence Information
- Coding Sequence
- ATGAGGCAAATTTTAAAGGAAGAACCAGTGCCACGTGCATGGCCACAACCCGCACTTGCTGATACTGCTACAGTTGGAGTTGGTAGAGCACATTTTGAAAAGCAACCCCCGAGCAATTTAAGAAAGAgtaatttctttcatttcgtAATTGCATTGTATGATCGTGGTGGTCAACCAATCGAAATTGAACGAACTGCATTTATTGGATTTGTGGAAAAAGATcaggaatCTGAGGgtcaaaaaacaaacaatGGCATTCAATATCGACTTCAATTGCTCTACGCTAATGGTAagctaattaaattattctcgaTTAAGtgttaa
- Protein Sequence
- MRQILKEEPVPRAWPQPALADTATVGVGRAHFEKQPPSNLRKSNFFHFVIALYDRGGQPIEIERTAFIGFVEKDQESEGQKTNNGIQYRLQLLYANGKLIKLFSIKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01464830;
- 90% Identity
- iTF_00438541; iTF_01101853; iTF_01129128; iTF_00059233; iTF_01364418; iTF_00721037; iTF_00628896; iTF_01464830; iTF_00266240; iTF_00265458; iTF_00263160; iTF_01298943;
- 80% Identity
- -